KEGG   Streptomyces albireticuli: SMD11_1659
Entry
SMD11_1659        CDS       T05230                                 

Definition
(GenBank) putative NDP-hexose aminotransferase
  KO
K13310  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase [EC:2.6.1.106]
Organism
salj  Streptomyces albireticuli
Pathway
salj00523  Polyketide sugar unit biosynthesis
salj01100  Metabolic pathways
salj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salj00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SMD11_1659
Enzymes [BR:salj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.106  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase
     SMD11_1659
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase AMP-binding
Other DBs
NCBI-ProteinID: ARZ67320
UniProt: A0A1Z2KZ69
LinkDB
Position
1884371..1885531
AA seq 386 aa
MNVPFLDLKAPYRELRADIDAALGRVAASGRYLLGPELDAFEAEFAAYCGNEHCVAVGSG
CDALELALRALGIGPGDEVVVPAHTFIATWLAVSATGARPVPVDPSPDGLSMDLGLVEAA
LTPRTRAVLPVHLYGHPADMDPLLELAGRHGLAVVEDAAQAHGARYRGRRTGSGHVVAFS
FYPGKNLGAMGDGGAVVTGDAAVAERVRLLRNFGSREKYRHEVRAGNSRLDEFQAAVLRA
KLPRLDAWNARRAAVAARYGEGLAGLPGIVLPEAAPWADPVWHLYVIRSAERDALRRELD
RAGVATLIHYPVPPHRSPAYADDPAGAPEGTHPRTERLAAQVLSLPLGPHLGDDEAGAVV
AAVAAAVAATGGAGAGRRLPQPTEKR
NT seq 1161 nt   +upstreamnt  +downstreamnt
gtgaacgtgcccttcctcgatctgaaggccccctaccgggagctgcgggccgacatcgac
gccgcgctcggccgggtcgccgcgtcgggccgctatctcctcggcccggaactcgacgcg
ttcgaggcggagttcgcggcctactgcggcaacgagcactgcgtcgccgtcggcagcggc
tgcgacgcgctggagctggcgctgcgcgccctgggcatcggccccggcgacgaggtggtg
gtgcccgcgcacaccttcatcgccacctggctggccgtgtccgcgaccggggcccggccg
gtgcccgtggacccgtccccggacgggctgtccatggacctcgggctggtcgaggcggcc
ctgacgccgcgcacccgggccgtgctgccggtccacctgtacggccacccggccgacatg
gacccgctgctggagctcgccgggcggcacggactcgcggtcgtggaggacgcggcgcag
gcgcacggcgcccgctaccggggccgccggaccggctccgggcacgtggtcgccttcagc
ttctacccgggcaagaacctgggcgcgatgggcgacggcggggcggtcgtcaccggtgac
gccgccgtggccgaacgggtgcggctgctgcgtaacttcgggtcccgggagaagtaccgg
cacgaggtgcgggccggtaattcccggctcgacgagttccaggccgcggtgctgcgcgcc
aagctgccgcgcctcgacgcctggaacgcccgccgggccgcggtggccgcccgctacggg
gaggggctggccggcctgccgggcatcgtcctcccggaggccgccccgtgggccgacccg
gtgtggcacctgtacgtgatccgcagcgcggagcgcgacgcgctgcgccgcgagctggac
cgggcgggggtggcgacgctgatccactaccccgtcccgccgcaccggtccccggcctac
gcggacgacccggccggcgcgccggagggcacccacccgcgcaccgaacgcctggcggca
caggtcctcagcctgccgctcgggccccacctcggcgacgacgaggccggcgccgtggtg
gcggccgtcgcggcggcggtggcggccaccggcggcgccggggccggccgccgccttcct
caaccgacggagaaacgatga

DBGET integrated database retrieval system