KEGG   Streptomyces albireticuli: SMD11_2283
Entry
SMD11_2283        CDS       T05230                                 

Gene name
strK
Definition
(GenBank) alkaline phosphatase
  KO
K04342  streptomycin-6-phosphatase [EC:3.1.3.39]
Organism
salj  Streptomyces albireticuli
Pathway
salj00521  Streptomycin biosynthesis
salj01100  Metabolic pathways
salj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salj00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SMD11_2283 (strK)
Enzymes [BR:salj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.39  streptomycin-6-phosphatase
     SMD11_2283 (strK)
SSDB
Motif
Pfam: Alk_phosphatase Metalloenzyme
Other DBs
NCBI-ProteinID: ARZ67934
UniProt: A0A1Z2L0X4
LinkDB
Position
2691681..2693060
AA seq 459 aa
MGSRPYRRRLAWGAAALLAAGVAVPAAYAASDSGDASGQGTPAALSAGHGAKKAKNVILL
IGDGMGDSEITLARDYTVGAAGRLNMDKFPLTGSYTTYSVDKNGKPDYVTDSAASGTGWA
TGQKTVNGRISKTPGTDKPMTTILELAQRNGLATGSVTTAELTDATPAVLASHATDRSCA
GPADMKACPADTVAKGGPGSIAEQSVNHKVDVLLGGGKARFDQKITEGRFKGGTVTQQAE
KLGYQVVTDDKGLKKARPGKPVLGLFADGNVPVEWTGKAAAQGGTEPQRCVTSNPERKAG
TPALDDQTRKALQLLEAKQKGSKKGFFLQVEGASIDKRDHAADPCGQIGETAALDRAVKV
ARAYAAAHPDTLVITTADHAHTSQIVPLEATPPGLSSTLVTNEGGRLKVNYSTNTPGKAQ
EHTGTQVRIAAQGPQAERVLGVTDQTQLFTTIRSALTLR
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgggttctcgtccgtaccggcgccgtctcgcctggggtgccgccgcgctgctcgccgcc
ggggtcgcggtaccggccgcgtacgccgcgtcggactcgggcgacgcgtccgggcagggg
acgcccgccgcgctgagcgcgggccacggcgccaagaaggccaagaacgtcatcctgctc
atcggcgacggcatgggcgactcggagatcaccctggcccgtgactacaccgtgggcgcg
gcgggccgcctgaacatggacaagttcccgctcaccggctcgtacaccacgtactccgtc
gacaagaacggcaagccggactacgtcaccgactccgcggccagcggcaccggctgggcg
accgggcagaagaccgtcaacggccggatatccaagacgcccggcaccgacaagccgatg
acgacgatcctggagctggcccagcgcaacggcctggcgaccggcagcgtcaccaccgcc
gagctcaccgacgccaccccggccgtgctcgcctcgcacgccaccgaccgcagctgcgcg
ggcccggccgacatgaaggcgtgcccggccgacacggtcgccaagggcggccctggctcc
atcgccgagcagagcgtgaaccacaaggtggacgtgctgctgggcggcggcaaggcccgc
ttcgaccagaagatcaccgagggccgcttcaagggcggcaccgtcacccagcaggccgag
aagctcggctaccaggtggtcaccgacgacaagggcctgaagaaggcccggcccggcaag
cccgtcctcggcctcttcgccgacggcaacgtgcccgtcgagtggaccggcaaggccgcc
gcgcagggcggcaccgagccgcagcgctgcgtgacgagcaacccggagcgcaaggccggc
acgccggccctggacgaccagacccgcaaggcgctccagctgctggaggccaagcagaag
ggctccaagaagggcttcttcctccaggtcgagggcgcctcgatcgacaagcgggaccac
gccgccgacccctgcggccagatcggcgagaccgcggccctggaccgggcggtgaaggtg
gcccgcgcgtacgccgccgcccaccccgacacgctcgtgatcaccaccgccgaccacgcc
cacaccagccagatcgtcccgctggaggcgaccccgcccggcctgtcctccaccctcgtg
acgaacgagggcgggcggctgaaggtgaactactccaccaacaccccgggcaaggcccag
gagcacaccggcacccaggtgcgcatcgcggcgcagggcccgcaggcggagcgcgtcctc
ggcgtcaccgaccagacgcagctcttcaccacgatccgctcggcgctcaccctgcgctga

DBGET integrated database retrieval system