KEGG   Streptomyces albireticuli: SMD11_4237Help
Entry
SMD11_4237        CDS       T05230                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
salj  Streptomyces albireticuli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like
Motif
Other DBs
NCBI-ProteinID: ARZ69845
UniProt: A0A1Z2L6C6
LinkDB All DBs
Position
4857523..4859310
Genome map
AA seq 595 aa AA seqDB search
MRPVGSKYLLEEVLGRGATGTVWRARQREAAGAEAAVAGQPGEALAIKVLKEELANDADV
VMRFLRERSVLLRLTHPNIVRTRDLVVEGDLLALVMDLVDGPDLHRYLRENGPFTPVAAA
LLTAQIADALAASHADGVVHRDLKPANVLLAGTGGPTLHPMLTDFGIARLADSPGLTRTH
EFVGTPAYVAPESAEGRPQTSAVDIYGAGILLYELVTGRPPFAGATALEVLHQHLSAEPR
RPSTVPEPLWKVIERCLSKRPEERPGAENLARALRVVAAGVGVHASPAQAEAALGVAALL
APDPEPALVPGTGQGSAPAAGGGDADPTQVLPSTGGAPAPWADPDAATSFLPTTPPAPGG
DADPTRVMPAGSGGAPDPTRAMPPVPPGPPGGDGEHPWQTQMRAARDRNDQTQVQYLDPS
EDPLRRRPQRRAPQQPPQQPQQPQRPPQRAYGQQPPQPYAQQPQQYAPRPPQPQQAQPQP
YAPPRPPERRRRGAEPQQRYQEPQPQRYAPEPPAPRREPRPPRQRSANPMRIPGLGCLKG
CLFMIVLLIVGSWLVWEFTPLKDWVADGKSFWDATWGWIKDVKDWISGLGSSKGQ
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
gtgcggccggtaggtagcaagtacctgctcgaggaggtgctcggacgcggcgcgacgggc
accgtctggcgagcccgccagcgggaggcggccggcgccgaggccgcggtggccgggcag
cccggcgaggccctcgcgatcaaggtgctcaaggaggagctggccaacgacgcggacgtc
gtgatgcgcttcctgcgggagcgctccgtcctgctgcggctcacccaccccaacatcgtc
cgcacccgcgacctcgtcgtcgagggcgatctcctcgccctcgtcatggacctcgtcgac
ggcccggacctgcaccgctacctgcgcgagaacggccccttcaccccggtggccgccgcg
ctgctcaccgcccagatcgcggacgccctcgccgccagccacgcggacggcgtcgtccac
cgcgacctcaagccggccaacgtcctgctggccggcaccggcggtccgacgctgcacccg
atgctcaccgacttcggcatcgcgcgcctcgccgactccccgggcctgacccgcacccac
gagttcgtgggcacgcccgcctacgtcgcgcccgagtccgccgagggccgcccgcagacc
tccgccgtcgacatctacggcgccggcatcctgctgtacgagctggtcaccggccgcccg
ccgttcgccggggccaccgccctggaggtcctgcaccagcacctcagcgccgagccgcgc
cgccccagcaccgtgcccgagcccctgtggaaggtcatcgagcgctgcctgagcaagcgg
ccggaggagcggcccggcgcggagaacctggcccgcgcgctgcgcgtcgtcgccgccggc
gtcggcgtgcacgcctccccggcccaggcggaggccgcgctcggcgtcgccgcgctgctc
gcccccgacccggagcccgcgctggtccccggcacggggcagggctcggcaccggccgcc
ggcggcggtgacgccgaccccacgcaggtgctgccctcgaccggcggcgcgcccgccccc
tgggccgacccggacgccgcgaccagcttcctgcccacgaccccgcccgcgcccggcggc
gacgccgacccgacccgggtcatgccggccggctccggcggcgcccccgacccgacgcgc
gccatgccgcccgtaccgccggggccgcccggtggcgacggcgagcacccgtggcagacg
cagatgcgcgcggcccgcgaccgcaacgaccagacccaggtgcagtacctcgacccgagc
gaggacccgctgcgccgccgcccccagcggcgcgccccgcagcagccgccccagcagccg
cagcagccccagcggccaccgcagcgcgcgtacgggcagcagcccccgcagccgtacgcg
cagcagccccagcagtacgcgccgaggcccccgcagccgcagcaggcccagccgcagccg
tacgccccgccgcgtccgccggagcgccgccgccgtggcgccgagccgcagcagcgctac
caggagccccagccgcagcggtacgccccggagcccccggccccgcgccgggagcccaga
ccgccgcggcagcgcagcgcgaaccccatgcggatcccgggtctcggctgcctcaagggc
tgccttttcatgattgtcctgttgatcgtcggttcctggctcgtctgggagttcaccccg
ctgaaggactgggtcgccgacggcaagagcttctgggacgccacctggggctggatcaag
gatgtgaaggactggatctccggcctcgggtcgtccaagggtcagtag

DBGET integrated database retrieval system