KEGG   Streptomyces albireticuli: SMD11_5752Help
Entry
SMD11_5752        CDS       T05230                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
salj  Streptomyces albireticuli
Pathway
salj03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:salj00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    SMD11_5752
Enzymes [BR:salj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SMD11_5752
DNA repair and recombination proteins [BR:salj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SMD11_5752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ARZ71328
UniProt: A0A1Z2LAT3
LinkDB All DBs
Position
complement(6521273..6522226)
Genome map
AA seq 317 aa AA seqDB search
MGHATIPVIQPMLATPGPLPAPGDEAAWAFEVKWDGVRCVVTAPGDGTVRLTTRTGNDAT
ATYPELRALGERFRRHAAVLDGEVVVLDTQGRPDFGLLQRRMNVLNPRRAAQLAMEYPVH
LMVFDIMHLDDRSLLKLPYRDRRSVLAGLRLGGTHWSVPAYMEGHGRRAWDATLKDGFEG
VLAKRLSSLYLPGVRSPEWRKTKHVTTIDVVIGGWAEGRGMLTGLPGAFLTGLDEPGGLR
FTGSVGSGLSERERRDLARYLEVLARPESPFAGPTGVAGAHWVEPRLIAEVTFSGWTPAG
HLRHPTWHRLRPDLTRL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggccacgccacgatccccgtgatccagccgatgctcgccacccccggcccgctgccc
gccccgggggacgaggcggcgtgggcgttcgaggtcaagtgggacggcgtacgctgcgtc
gtcaccgcgcccggcgacggcaccgtccgcctcaccacccggacgggcaacgacgccacc
gcgacctacccggagctccgggcgctcggcgagcggttccgccgccacgcggccgtgctg
gacggcgaggtcgtcgtcctcgacacccaggggcggcccgacttcgggctgctccagcgc
cgcatgaacgtgctgaacccgcgccgcgccgcccagctggcgatggagtaccccgtccac
ctgatggtcttcgacatcatgcacctcgacgaccggtcgctgctcaagctgccctaccgg
gaccgccggtccgtcctggccgggctccgcctgggcggtacgcactggtcggtgcccgcc
tacatggaggggcacggccggcgggcctgggacgccaccctcaaggacggcttcgagggc
gtgctggcgaaacggctctcctccctctacctcccgggcgtccgctcacccgagtggcgc
aagacgaagcatgtgacgaccatcgatgtggtcatcggcggctgggccgagggccggggc
atgctgaccgggctgcccggggcgttcctcaccggcctggacgagccgggcggcctgcgc
ttcaccggctccgtcggctcggggctgtccgagcgcgagcggcgcgacctcgcccgctat
ctggaggtcctggcccgcccggagtcacccttcgcggggcccacgggggtggcgggcgcg
cactgggtcgagccccggctcatcgccgaggtcaccttctccggctggaccccggcgggc
catctgcgccacccgacctggcaccggctgcgccccgacctgacccggctgtga

DBGET integrated database retrieval system