KEGG   Streptomyces albireticuli: SMD11_6506Help
Entry
SMD11_6506        CDS       T05230                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
salj  Streptomyces albireticuli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ARZ72082
UniProt: A0A1Z2LCS3
LinkDB All DBs
Position
complement(7462709..7463770)
Genome map
AA seq 353 aa AA seqDB search
MELPVMPPVRPMLAKTASAIPPGMQYEAKWDGFRAIVFRDGDAIEIASRTTKPLTRYFPE
VVRALLAQLPARCVVDGEIVVVRDGRLDFDALLERIHPAASRVARLAELTPASFIAFDLL
ALGDESLLDLPQSGRREALTTALRDVAAPVHVTPVTDDLDVARAWFERFEGAGLDGVVAK
PPGLPYRPGERVMTKVKHERTADCVLAGLRLHKSGPVVGSLLLGLHDDAGRLQHVGVCAS
FPMRRRAELMEELEPLRMADVHGHPWERWTDPDAQAGGRLPGGPSRWTGTKDLSWIPLRP
ERVCEVAYDHLQGDRFRHTTQFRRWRPDREPADCTYAQLEETARYDLADVLSL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggaactcccggtgatgcccccggtgcggccgatgctggccaagacggcgtccgccatc
ccgcccggtatgcagtacgaggcgaagtgggacggcttccgggccatcgtcttccgcgac
ggcgacgccatcgagatcgccagccgcaccacgaagccgctgacccgctatttccccgag
gtggtccgggccctgctggcacagctccccgcccgctgcgtcgtggacggcgagatcgtc
gtcgtccgtgacgggcggctggacttcgacgccctgctcgaacgcatccacccggcggcc
tcccgggtcgcccgtctggccgagctcaccccggcctcgttcatcgccttcgacctgctg
gcactcggggacgagtcgctcctggacctcccccagagcggccgccgggaggccctgacc
accgcgttgcgcgacgtcgcggcgcccgtgcacgtcacccccgtcaccgacgacctggac
gtcgcccgggcgtggttcgagcggttcgagggcgccggcctggacggcgtcgtcgccaag
ccgcccggcctcccctaccggccgggcgaacgcgtcatgaccaaggtcaagcacgagcgg
accgccgactgcgtcctcgcggggctgcgcctgcacaagagcgggcccgtcgtcggctcg
ctgctcctcggcctccacgacgacgccgggcggttgcagcacgtcggcgtctgcgcctcc
ttccccatgcgccgccgcgcggagctgatggaggagctggagccgctgcggatggccgac
gtccacggccacccgtgggagcggtggacggacccggacgcgcaggccggcggccggctg
ccgggcgggcccagccgctggaccggcaccaaggacctctcctggatcccgctgcgcccc
gaacgggtctgcgaggtggcctacgaccacctccagggcgaccgcttccgccacaccacg
cagttccgccgctggcgcccggaccgggagcccgccgactgcacgtacgcgcagctggag
gagacggcccggtacgacctggcggacgtcctcagcctctga

DBGET integrated database retrieval system