KEGG   Streptomyces albireticuli: SMD11_6507Help
Entry
SMD11_6507        CDS       T05230                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
salj  Streptomyces albireticuli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ARZ72083
UniProt: A0A1Z2LCP1
LinkDB All DBs
Position
7463883..7464971
Genome map
AA seq 362 aa AA seqDB search
MGGDAVELSAGGRTVRISHPDKVYFPERGFTKYDVASYYLSVADGVVRALRDRPTTLERY
PDGVGGESFFQKRAPKNLPDWIPTGRISFPSGRYADEICPGEIAAVLWAANLGCLTFHPW
PVRRADTDHPDELRIDLDPQPGTDYADAVRAALDLREVLAGLGLTGWPKTSGGRGLHVFV
PIAPRWTFTQVRRAAIAVARELERRSPRTITTAWWKEERGEKVFVDYNQTARDRTIASAY
SVRPRAHAPVSAPLTWEEVPGAVPRDFDLGSMPGRYAEVGDVHAGMGDEPCGLEAALELA
DRDEREHGLGDLPYPPEHPKMKGEPKRVQPSRARKEGTGEGGARKRSGGGDGAGEGPEPA
TG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtgacgcggtggagctctctgcgggcgggcggacggtgcggatctcccacccc
gacaaggtctatttcccggaacgcggcttcaccaaatacgacgtggcgtcctactacctg
agcgtcgccgacggcgtcgtccgcgcgctgcgcgaccggccgaccaccctggagcgctat
cccgacggcgtcggcggcgagtcgttcttccagaagcgggccccgaagaacctccccgac
tggatcccgaccggacgcatctccttccccagcggccgctacgcggacgagatctgcccc
ggggagatcgcggccgtgctgtgggcggccaacctgggctgtctgaccttccacccctgg
ccggtgcggcgggccgacaccgaccaccccgacgagctgcgcatcgacctcgacccgcag
ccgggcaccgactacgcggacgcggtgcgcgccgccctcgacctgcgcgaggtgctggcg
ggtctggggctgacgggctggcccaagacgtccggcgggcgcggcctgcacgtcttcgtg
ccgatcgcgccccggtggacgttcacgcaggtgcggcgggcggcgatcgccgtggcgcgg
gagctggaacggcggtcgccgcggacgatcaccacggcgtggtggaaggaggaacgcggc
gagaaggtgttcgtggactacaaccagaccgcccgcgaccgcaccatcgccagcgcctac
tccgtacgcccgcgcgcgcacgccccggtctccgccccgctgacgtgggaggaggtgccc
ggtgccgtgccccgggacttcgacctgggcagcatgcccgggcggtacgccgaggtgggt
gatgtgcacgcgggaatgggtgacgaaccctgcggcctggaggcggccctggaactggcc
gaccgggacgagcgcgagcacggcctgggcgacctcccctacccgccggagcacccgaag
atgaagggcgagccgaagcgcgtccagcccagccgggcccgcaaggagggtacgggcgaa
gggggcgcccgcaagcggtccgggggcggcgacggagccggggaagggccggagccggcc
accggctga

DBGET integrated database retrieval system