KEGG   Salinimonas sp. KX18D6: FBQ74_07165Help
Entry
FBQ74_07165       CDS       T06006                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
salk  Salinimonas sp. KX18D6
Brite
KEGG Orthology (KO) [BR:salk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FBQ74_07165 (ahpF)
Enzymes [BR:salk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FBQ74_07165 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like GIDA FAD_binding_2 DAO Thi4 FAD_oxidored Lycopene_cycl AlaDh_PNT_C NAD_binding_8 FAD_binding_3 K_oxygenase Thioredoxin_4 Thioredoxin_9 3HCDH_N Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: QCZ93278
UniProt: A0A5B7YCJ1
LinkDB All DBs
Position
1640497..1642083
Genome map
AA seq 528 aa AA seqDB search
MLTKEILQALKGYAESMKKEVTFVLQTGEHSKRDELVTFLSDIAGVSDNIKFEERDTDGV
LRSSLSFLLEADGNDTGIRFSGIPAGHEFNSLVLAMLHASGGSELKIDDSLKSIVKGVSD
DLHFEVFISLSCHNCPEVVQALNQFALLNPNITTEMIDGGLYQNVVEERDIQGVPSVYLN
GELFANGKVDAAVLIDKLLERDPSLKDANKGESLPLQDVTVIGGGPAGVSSAIYSARKGL
KVAMVADRFGGQVKDTMGIENLISVPKTTGPELVGNLAEHMKDYDITFKEHVRVEKIEKG
NVKTITLSSGETIKTRSIIIATGARWKQLGIPGEQENVGNGVAYCPHCDGPFFKGKDVAV
IGGGNSGIEAALDLAGIVKSVTVFEFMPELKADKVLIDQAEKRDNVTIIRNAATKEIIAD
NGKVAAIDYQDRETEETHRKHLSGVFVQIGLVPNSQFLTETLDLTQYGEIIVDEKCNTSE
PGIFAAGDVTTVPYKQIVVSLGEGAKASLAAFEYLLTHQTEEEISEVA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtgttaactaaagaaattttacaagcgctgaaaggctatgctgagtctatgaagaaagag
gtaacgttcgttctgcagactggcgaacacagcaagcgtgacgaactcgtgacgtttctg
tcagatattgccggcgtaagcgataatatcaagtttgaagagcgagataccgatggcgtt
ttgcgtagctcgctaagctttcttttagaagcagacggtaacgataccggtattcgtttt
tcgggtattccggcaggacatgagttcaattcactggtattggcaatgttgcatgcttct
ggtggctcagagcttaaaattgacgacagcctgaaaagcatcgttaagggcgtatctgat
gatctccactttgaagtattcattagccttagctgccataactgtccggaagtggttcag
gcattgaaccaatttgcgctgctaaatccaaatataaccactgaaatgatcgacggcgga
ctgtaccagaatgttgttgaagagcgtgacattcagggggtaccttctgtgtacctcaac
ggtgaattattcgccaatggtaaggttgatgccgcggtattgatagataagttgcttgaa
cgggatccttcgcttaaagatgcaaacaaaggtgagagtttgccgcttcaggatgtcact
gtcatcggcggcggtccggctggtgtgagttcagcaatttacagtgctcgtaaaggcctg
aaagttgcgatggttgcagaccgttttggcgggcaggtgaaagacaccatgggcatcgaa
aacctgatttctgtacctaagactaccggcccggagcttgttggtaatctggctgagcac
atgaaggactatgacatcacgtttaaagagcatgtgcgggttgaaaagattgaaaaaggt
aatgtaaagactattacgttgtcttcaggcgaaacaattaaaacgcgctcaatcataatt
gcaaccggtgcgcgctggaagcaattgggcatacccggtgagcaggaaaacgtaggtaat
ggcgttgcatactgtcctcactgcgatggtccgttctttaaaggcaaagatgtcgctgta
atcggtggtggtaactcaggcatcgaggctgcacttgatttggccggaatcgtaaaatca
gtgacagtatttgagtttatgcctgagctgaaagctgacaaagtactgatagatcaggca
gaaaagcgtgacaacgtaactattatacgtaacgctgcaaccaaagaaatcatcgctgac
aatggcaaagttgcggcgattgactatcaggacagggagacagaagagacgcatcgtaag
cacctgtctggcgtattcgttcagattggtctggtgccaaacagtcagtttttgactgaa
acgcttgatttgacccagtatggcgaaatcattgtcgatgaaaaatgcaatacatctgag
cctggtatctttgccgccggtgatgttacaacagtgccgtacaagcaaattgttgtgtca
ttgggtgagggtgcaaaagcgtcactggcagcatttgaatatctgctgactcatcagaca
gaagaagagatctctgaagtagcctga

DBGET integrated database retrieval system