KEGG   Salinimonas sp. KX18D6: FBQ74_07665Help
Entry
FBQ74_07665       CDS       T06006                                 

Definition
(GenBank) PAS domain S-box protein
Organism
salk  Salinimonas sp. KX18D6
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAS_9 PAS PAS_4 PAS_8 PAS_10
Motif
Other DBs
NCBI-ProteinID: QCZ93371
LinkDB All DBs
Position
1753556..1758541
Genome map
AA seq 1661 aa AA seqDB search
MYTQVCHWSDLVLFMSVNVRLSMPAVLFGLLYVLAPSRVWAMAAQVQAMPATLFAIGFWS
LVSIAVLFIILFVAKVFANKRLLRAQQSGQAEIDKLVSRQDNLPTGIIYLDDAHEILTLN
RTAAAVLGQKPDLLMGQPVTDVLPESVRDALSKALQADWEQILVCKLPARDRYFRIRVIP
NMPDTTRCNGQLVIEDVDQYEHKLSNAEVMEAHQYALWNQKALGIIQLRPATGDVSINES
MAAWLGQSAQDVQSIESLFSDKSKNAVVQLLSRAAEGHSDSIEVDLVCADRPVPVTLYAS
AVAYTLEDEPLIHLTCINRQAERDFASQAATHKRHFQSLCAMLPHSTYLLNNTLTIEHYN
REFAKTFDLESGVVKGQKITELAGLSEKIKKLHSTLQGTMLKQEVITLENEQGQTRTLKL
LLQPISENNQRTAVLVVVQDLTDNIALEDERNHARQRLLSFMDQAPMGVVMFDENDIIKE
SNHTTSRQLGLSGDELRGKSFYNLFTNADDARRAAKKLQRHDRFAELPARLNGALKPLSA
TLHASKISEIPQEFVCWIGGREEQEFLNTRFEKLVKYASVPVGILSEDGFSHLNSAACVF
FGLDDEDELLGKSPDFRPLNVSDADSQMMADKLELAKTQGQVLTFNWQHAHSNEELPCEV
TLIPIHRDGALQSVICIWVDLRAIEQSNAARMEAVRLREAAQREVEEKQQMLATSEDKLQ
RQSATLAETEQSLASTEKRLNQAEEDLSEKLETISDLQQAHKDISEHLASLQDDYASNRA
LLAESQQINTELEEQLSRSSAKVGSLEQQRSQIADALQYSEKKYRQAQTQLDESRKETGR
LKDEQQAQQHEVQQYVEQIDTLKASIEEKDHELTAVSSKIQTLQSQLVSSGQTSEKLREQ
LLNQRKASEEAEKQRRQIELACQAAEAELAAKARNIDHLQHEMEMLEKMSQQEKGDMEAY
ARQLQQELEQKQSQLSQTESALVDIRAQAEADREEKAKQQDTLTRLQLEMQEAEAQAKAR
QEEMAELNQAREKEQARLQEALDAKHALLTDTAQNLEEAKRQNEAAAQEKARQQAIVSKL
QEEMQQTRAEAESNQQKLAELNAERMEEHARLQEDLKAKQLQLQEAKATLQDNQQRTESD
KEERVKQQAVFEKLKAELSSMESRSAEQQAAIEQTEKDRQNEQEAMEKALAARQAQLDET
KAELQTRQQQMDEEKRAREAQQSLLDQLQQEMSEMQARAQQQKDEMASSEKAREEEQQRL
TQELQDKQEQLSAAQSELEARQQQMEEEKLAREEQQAMLEQLKSELEDVAQRASKQQEMM
SGSDEQWRKHHEEIEAQKKQLQQALNQAENQNNAMQTQLEQSREALTQANSKVSKTQSEE
QKLQAELDEARDKAEALNEKLRQQEAQEAELKTQVQKQQSALGEREQSISELKSSQQALT
EKLAAVEKEYAQTKASLKQQDSSQNELSDSLRQLEEELNQSKAQLTGKEEALEKAQARLK
ESESKLAEQEKALIDAQKAELQSAQDNSHEDAPAAREIPEFANDPVPDDPHVWFDLLPYL
QQNEQVGSLAQSLTSLMDTMSEAVKDIDDAVAEDRHGKILLTSRNLVKLLRTIHSEPLND
MAERFETDLEYNNVDNISIFWPIARQNLMKTQRVIYSHLYQ
NT seq 4986 nt NT seq  +upstreamnt  +downstreamnt
atgtacactcaggtatgtcactggagcgacctggttttatttatgtctgtaaatgtccgg
ctatcgatgcctgctgttttattcggtttattatatgtactggccccttcgcgtgtctgg
gcgatggccgcgcaggtacaagccatgcccgctacattgtttgccatcggcttctggtct
ctggtaagcatcgctgtactttttatcatcttatttgttgccaaggtctttgcgaataag
cgcttattgcgcgcgcagcagagcggccaggcagaaattgacaagctggtatcacgtcag
gacaacctgcctaccggtatcatctatcttgatgacgctcacgaaattttgacactgaac
agaactgcggcagcggtattaggacaaaagccggatttgttaatgggtcagccggtgacc
gatgtattgcctgagagtgtccgggacgcattgagtaaagcgttgcaagccgactgggaa
caaatactggtgtgtaagcttcctgcccgtgaccgttattttcgtattcgtgtgattccc
aatatgccggatacgacacggtgcaatggtcaactggtaatcgaagacgtcgaccagtat
gagcataaactcagtaatgctgaagtgatggaggcacaccagtacgcattgtggaatcag
aaggcgctggggataattcagttacgccccgccacgggcgatgtcagtattaacgagagc
atggctgcatggctgggtcagtccgcacaagatgttcaaagtattgaatcgttattttcc
gataaaagtaaaaatgcggttgtacagttgttatcccgggctgcagaaggtcatagcgat
agcattgaggtcgatttggtctgtgccgacagaccggttcccgttacactctacgccagt
gcggtagcgtatacgttggaggacgaaccgcttattcacctcacttgcatcaatcgtcag
gctgaacgtgattttgccagtcaggctgcgacacataaacgccacttccagtccctttgt
gcaatgctgcctcacagcacttatctgcttaataacacactaactattgaacattacaat
cgtgagttcgccaaaacatttgatctcgaatcaggtgtggtcaagggccagaagattact
gagctggctggattgagtgaaaaaattaaaaagcttcacagtacgctgcagggcacaatg
ctcaaacaggaggtgattactcttgaaaacgagcaaggtcagacccggacacttaagtta
cttctacagccgataagtgaaaataatcagagaacggcagtactggtggtagtccaggat
ttgaccgataacattgcacttgaagatgaacgtaatcatgcccgacaacgtctattgagc
tttatggatcaggctccgatgggtgtggtgatgttcgatgaaaacgatattatcaaagag
agcaaccatacaacatccagacagctcggtttatctggtgatgaacttcgcggcaagtct
ttttataacctgttcactaatgctgatgacgcccgcagagcggctaaaaagctacagcga
cacgacagatttgcagagctgcctgctcgtttaaacggtgcgctcaagccgctgtcagcg
acgttacatgcgagtaaaatcagtgaaattccacaggaatttgtttgttggataggcggc
agagaagagcaggagttcctgaatacccgctttgaaaaactggttaaatacgccagtgta
ccggtggggatcctctctgaggatggcttctcacatttgaattctgctgcctgtgtcttc
ttcgggttggatgatgaagacgaactgctgggtaaaagcccggatttccgcccgctgaat
gtcagcgatgcagatagtcagatgatggcagataaactcgaactggcaaagacgcagggg
caggtactaacgtttaactggcagcatgcacacagtaacgaggaactgccgtgcgaggtc
acacttattcctattcaccgtgatggtgcattgcagtcggttatctgcatatgggttgac
cttcgcgccattgagcagtcaaacgcagctcggatggaggccgtgcgtttaagggaggct
gcacaacgtgaagtggaagaaaagcagcaaatgctggcaaccagcgaagacaaattgcag
cgacagtctgcaacgttggcagaaactgagcagtctctggcatccacagagaagcgactc
aatcaggccgaagaagatttatctgaaaaactcgaaactatttcagaccttcaacaggcg
cataaagatatcagtgagcatctggccagtttgcaggatgactatgccagcaaccgcgct
ttactggctgagagccagcaaattaacacagagctggaagagcagttaagccgttcaagc
gcaaaagtcggcagtcttgagcaacagcgtagccagatagcggatgcccttcagtacagc
gagaaaaagtatcgccaggcacagacgcagcttgatgaaagcaggaaagaaaccggacgc
ctgaaggacgagcagcaagcgcaacagcatgaagtgcagcagtatgttgaacaaattgat
acgcttaaagcatcaatagaggaaaaagaccacgaactaacagcagtaagcagcaagatt
cagacattgcagtcacagttagtcagctcgggtcagacatcagaaaagctgcgtgagcag
ttactgaatcagcgcaaggccagcgaagaggcagagaaacagcgtcgccaaatagagctg
gcatgtcaggcagcagaagctgaattagcggcgaaagccagaaatattgaccatctgcag
cacgaaatggaaatgctggaaaaaatgtctcagcaggaaaaaggggacatggaggcctat
gcaagacagttgcaacaagagttggagcaaaagcaatctcagctgagtcagactgaatcg
gcgctggtggatattcgcgctcaggcagaggcagatcgtgaagaaaaagcgaagcagcag
gatacgctgacgcgtttgcaacttgaaatgcaggaagcagaggcgcaggctaaagcccgt
caggaggaaatggctgaactgaaccaggcgcgcgaaaaggagcaggcacgtctgcaggaa
gcattggatgcgaaacacgccttattaaccgataccgctcagaatcttgaagaggcaaaa
agacaaaatgaagccgccgcacaggaaaaagcgcgtcagcaggcgattgtcagcaaactt
caggaagaaatgcagcaaacccgggcagaagcagaaagtaatcagcagaaactggctgaa
ttgaatgccgagcgcatggaagagcatgcgcgacttcaggaagatctgaaagcgaagcaa
ttacagctacaggaagcaaaggccacattgcaggataatcagcagcgcactgaatccgat
aaagaagagcgggttaaacaacaggcagtgtttgagaaactgaaggcagagctgtcatcg
atggagtcacgctcggcagagcaacaggcagctatagagcagaccgaaaaagaccgccag
aatgaacaggaggcaatggaaaaagcgctggctgcccgtcaggcgcagttagatgaaacc
aaagcagaattgcagactcgccagcaacaaatggatgaagagaaacgcgctagggaagca
cagcaatcgctgttagatcagctgcagcaggaaatgtcagagatgcaggcccgggcgcag
caacaaaaagacgagatggcgtccagtgaaaaggcccgtgaggaggaacagcagcgtctg
actcaggaattacaagataaacaggaacagctgagcgcagcgcagagcgaactggaagcc
agacagcagcaaatggaagaggaaaagctcgcccgcgaagagcaacaggctatgctggaa
cagcttaaatctgagcttgaagatgttgctcaacgcgcttcaaagcagcaggaaatgatg
agtggcagcgatgagcagtggcgtaagcatcatgaagaaattgaagcccagaagaagcaa
ctgcagcaggcactgaatcaggctgagaaccaaaataacgccatgcagacacagttggag
caaagtcgcgaggcattgacccaggcaaactcgaaagtctcgaaaacgcagagcgaagaa
caaaagcttcaggctgaacttgacgaggccagagataaagcggaggcgttaaatgaaaag
ctacgtcagcaggaagcgcaggaagcagagctgaaaacgcaggtacaaaaacaacaatct
gccctgggtgaacgtgagcagagcattagcgagctaaaatccagtcaacaggcgcttact
gaaaaactggctgccgtagaaaaggaatacgcacaaacaaaggcatcgctaaaacagcag
gattccagtcagaacgagttgagtgattcattgcgacagctggaagaagaattgaatcaa
agcaaggcccagcttaccggtaaggaagaggcactcgagaaagcccaggcaagattaaaa
gagagcgagagtaagctggcagagcaggaaaaagcactcattgatgcgcaaaaagccgag
ctacagtctgcacaggataacagccatgaggatgcacctgcggcgcgggaaataccggag
ttcgcaaacgatccggttcctgatgatcctcacgtatggttcgacctgctgccatatttg
caacaaaacgaacaggtaggctcgttagcgcagtcactgacctcgctaatggatacaatg
agtgaggcagttaaggatattgacgatgcagtggcagaagaccgccacggtaagatcctt
ctgaccagcagaaacctggtgaagctactgcgtaccattcattccgagccactaaacgac
atggctgaaagatttgaaacagatcttgagtacaacaatgtcgataatatttcgatattc
tggccaatcgcccgacaaaacctaatgaaaacccaacgggttatctattcacatctttat
cagtaa

DBGET integrated database retrieval system