KEGG   Salinimonas sp. KX18D6: FBQ74_08215Help
Entry
FBQ74_08215       CDS       T06006                                 

Gene name
fabA
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
salk  Salinimonas sp. KX18D6
Pathway
salk00061  Fatty acid biosynthesis
salk01100  Metabolic pathways
salk01212  Fatty acid metabolism
Module
salk_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:salk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FBQ74_08215 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:salk01004]
    FBQ74_08215 (fabA)
Enzymes [BR:salk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     FBQ74_08215 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     FBQ74_08215 (fabA)
Lipid biosynthesis proteins [BR:salk01004]
 Fatty acid synthase
  Component type
   FBQ74_08215 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: QCZ93470
LinkDB All DBs
Position
1867623..1868141
Genome map
AA seq 172 aa AA seqDB search
MSQQQDSFSREDLLACSRGEMFGPGNSQLPAPNMLMMDRIVSIKDEGGEFGKGEIVAELD
ITPDLWFFDCHFPGDPVMPGCLGLDAMWQLVGFFLGWSGGPGKGRALGVGEVKFTGQILP
TAKKVTYRINLKRVIKRKLFMGMADGIVEVDGREIYSAKDLKVGLFQDTSNF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaacaacaagatagctttagtcgtgaagaccttttagcctgcagtcgtggagaa
atgtttggccctgggaacagccaattgcctgcacctaatatgctaatgatggaccgtatc
gtttcaatcaaagatgagggcggtgaatttggcaaaggggaaattgttgctgaactggat
atcacacccgacttgtggtttttcgattgtcacttccccggtgatccggtgatgcctggc
tgtttagggttagacgcaatgtggcagctagtcggcttttttcttggctggagcggcggt
ccgggtaaaggccgggcactgggtgtaggtgaagttaaattcactggtcagattctgccg
acagcaaaaaaagtaacctaccggataaatctgaagcgtgtcattaaacgcaagctgttt
atgggaatggcagacggcatcgtagaagtcgatgggcgtgaaatttattctgctaaagat
ttaaaagttggcttgttccaagacacgtctaatttctaa

DBGET integrated database retrieval system