KEGG   Streptomyces albulus ZPM: SAZ_02825Help
Entry
SAZ_02825         CDS       T03896                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sall  Streptomyces albulus ZPM
Pathway
sall00473  D-Alanine metabolism
sall00550  Peptidoglycan biosynthesis
sall01100  Metabolic pathways
sall01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sall00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SAZ_02825
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAZ_02825
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SAZ_02825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sall01011]
    SAZ_02825
Enzymes [BR:sall01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SAZ_02825
Peptidoglycan biosynthesis and degradation proteins [BR:sall01011]
 Precursor biosynthesis
  Amino acid ligase
   SAZ_02825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATPgrasp_Ter ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AKA01539
LinkDB All DBs
Position
complement(643937..644995)
Genome map
AA seq 352 aa AA seqDB search
MVSQSRLVVGLTYNLRGESVEHFGAGPPREGYDAEFDEWETVQTVAGVLEGLGYRCVLIG
ALPALMERLLRGERWDVVFNLAEGHHGYGREAQVPALLEEWRIPFTFSDSLCLSLCLHKP
TTQLLLRQAGVTTAPFAVVREPHDIDGIDLPYPLFAKPVAEGTSKGIGADSRVDDARELR
STCTRLLQRHGQPVMVEPYLPGPEYTVGILGAGADARAVGVSQTLHDRRTTPFLTDLRKR
DASGQPVPVRALQDTGAAQRLAGLAVRAWRTLGCRDAGRVDLRCDAAGEPHVLDVNPLPG
LSPTYSPLPLQWAGTGRPYRQLIARIMTAAEHRLPCASSAVPASTAARRVGC
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgcagtctcggctggtcgtggggctcacctacaacctgcgcggtgagtccgtc
gagcacttcggcgccggcccgcccagggaggggtacgacgcggagttcgacgagtgggag
acggtgcagaccgtcgccggcgtcctcgaagggctcggctaccggtgcgtgctgatcggt
gcgctgccggcgttgatggagcgcctgctgcgcggcgaacgctgggacgtcgtcttcaac
ctcgccgaggggcaccacggctacgggcgcgaagcccaggttcccgcgctgttggaggag
tggcggatccccttcacgttctcggactccctgtgcctgtcgctgtgcctgcacaagccc
accacccagctgctgctgcggcaggcgggggtgacgacggcaccgttcgccgtcgtccgg
gagccccacgacatcgacgggatcgacctgccgtacccgttgttcgccaagccggtcgcc
gagggcaccagcaagggcatcggcgcggactcccgcgtggacgacgcgcgggagctgcgg
tcgacctgcacgcggctgctgcaacggcacggccagccggtgatggtcgagccgtacctc
cccggcccggagtacaccgtcggcatcctcggcgccggtgcggacgcccgggccgtcggc
gtgtcgcaaaccctccacgaccggcggacgacgcccttcctcaccgatctgcgcaagcgc
gacgcatcgggtcagccggtccccgtgcgggccctccaggacaccggcgccgcgcagcgc
ctcgccggcctcgccgtccgggcctggcgcacgctcggttgccgggacgccggccgggtc
gacctgcggtgcgacgcagccggtgagccccacgtcctggacgtcaacccgctgcccggc
ctcagccccacctactccccgttgcccctccagtgggccggcaccggccggccgtaccgc
cagctcatcgcgcgcatcatgaccgccgccgagcaccgcctgccgtgcgcgtcgtccgcc
gtgccggcgtcaacggccgcacgccgggtggggtgttga

DBGET integrated database retrieval system