KEGG   Streptomyces albulus ZPM: SAZ_04695Help
Entry
SAZ_04695         CDS       T03896                                 

Definition
(GenBank) peptidase S1
Organism
sall  Streptomyces albulus ZPM
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin
Motif
Other DBs
NCBI-ProteinID: AKA01834
LinkDB All DBs
Position
1030468..1031271
Genome map
AA seq 267 aa AA seqDB search
MAGAWLRGGAAAAAVFEAVCGAVLAAVPTATAMAGRPVPDTRIVGGGNADVRDVPWQVSL
RNRGGHICGGSIVRSDAVVTAAHCTVGAPPGSLSVRAGSAARGSGGQVVRVARVLRHPKY
DAATIDYDVAVLVLASPLRFGDGVRAVPLVPAGSEPSAGTPATVTGWGATRDGGALPERL
RRVDVPKLSDAYCKGAYGPSSITPRMTCYGYQEGRKDACQGDSGGPLVVDGRLAGIASWG
SGCAAPGHPGVYTKVSDPAIHDYITQS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggcatggctgcggggcggggcggcggcggccgcggtgttcgaggcggtgtgc
ggggctgtgctggccgccgttccgacggcgacggcgatggcgggccggccggtgccggac
acccgcatcgtcggcggggggaacgcggacgtgcgggacgtgccgtggcaggtgtcgctg
cgcaaccgcgggggccacatctgcggcggttcgatcgtccgctccgatgcggtggtgacc
gcggcccactgcaccgtgggggcgccaccggggtcactgagcgtccgggcgggcagcgcc
gcccgtggttcgggcgggcaggtggtccgggtggcccgggtgttgcggcacccgaagtac
gacgccgccacgatcgactacgacgtggcggtgctggtcctggcgtccccgctccggttc
ggtgacggggtgcgggcggtcccgttggtgccggcgggcagcgagccctcggcgggcacc
ccggcgacggtcaccggttggggcgcgacccgggacggcggcgcgttgccggagcggctg
cggcgggtcgacgtgcccaagctcagcgacgcctactgcaagggcgcctacgggccgtcc
tcgatcaccccgcggatgacgtgctacggctaccaggagggccgcaaggacgcctgccag
ggcgacagcggagggccgctggtggtggacggccgcctggcgggcatcgcgtcgtggggc
tcagggtgcgccgcgccggggcacccgggggtctacaccaaggtcagcgatccggcgatc
cacgactacatcacgcagtcgtag

DBGET integrated database retrieval system