KEGG   Streptomyces albulus ZPM: SAZ_10180Help
Entry
SAZ_10180         CDS       T03896                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sall  Streptomyces albulus ZPM
Pathway
sall00020  Citrate cycle (TCA cycle)
sall00480  Glutathione metabolism
sall01100  Metabolic pathways
sall01110  Biosynthesis of secondary metabolites
sall01120  Microbial metabolism in diverse environments
sall01130  Biosynthesis of antibiotics
sall01200  Carbon metabolism
sall01210  2-Oxocarboxylic acid metabolism
sall01230  Biosynthesis of amino acids
Module
sall_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sall_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sall00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAZ_10180
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SAZ_10180
Enzymes [BR:sall01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SAZ_10180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AKA02747
LinkDB All DBs
Position
complement(2345391..2347613)
Genome map
AA seq 740 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVEAYASTAGVTLETRDISLSGRIIASFPERLKEDQ
RIADALAELGELAKTPGANIIKLPNISASIPQLKAAIAELQEQGYALPDYPDDPKTDEER
DIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKAHPHRMGAWSADSKTNVATMGADD
FRSTEKSAVIAADGAVRIELAGDDGSTTVLRESVPVLAGEVVDASVMRVGPLREFLAAQV
AKAKAEGVLFSVHLKATMMKVSDPIVFGHVVRAFFPKTFAQYGEALASAGLTPNDGLGGI
YKGLEALPNGAEIKASFDAELAAGPELAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGEEADTLAVLPDSSYAGIYQAVIDDCRAHGAFDPATMGSVPNVGLMAQKAEEYGS
HDKTFEIPVTGTVRVLDGAGNAVLEQTVGAGDIFRMCQTKDAPIKDWVKLAVTRARATGD
PAVFWLDATRAHDAQLIEKVKAYLPEHDTEGLEIKILAPVEAITFSLERIRRGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFLALAVSFEHLATTTGNARAQVLADTLDRATGSFLNENKSPSRKLGGIDNRGSHFY
LALYWAQELAKQTDDAQLAEAFGPLAKTLAEQEQAIVDELIAVQGSPADIGGYYRPDAAK
ASAVMRPSKTLNQALAALKG
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatttacacccacactgacgaggccccggccctggcgacgtac
tcgttcctgccggtggtggaggcgtacgcctcgacggccggggtgacgctggagacccgc
gacatctcgctgtccggccggatcatcgccagcttcccggagcgcctgaaggaggaccag
cggatcgccgacgccctcgcggagctcggcgagctggccaagacgcccggcgcgaacatc
atcaagctgccgaacatctcggcctccatcccgcagctgaaggcggccatcgccgagctc
caggagcagggctacgcgctcccggactacccggacgacccgaagaccgacgaggagcgc
gacatccgcgcccgctacgacaaggtcaagggcagcgccgtcaaccccgtgctgcgcgag
ggcaactcggaccgccgcgcgcccgcgtcggtcaagaactacgccaaggcgcacccgcac
cgcatgggtgcctggtccgccgactccaagaccaacgtcgcgaccatgggcgccgacgac
ttccgctccaccgagaagtccgcggtgatcgccgcggacggtgcggtccgcatcgagctg
gccggcgacgacggcagcaccaccgtgctgcgcgagtcggtgccggtcctggccggtgag
gtcgtggacgcctccgtgatgcgggtcggtccgctgcgcgagttcctggccgcgcaggtc
gcgaaggccaaggccgagggcgtgctgttctccgtgcacctgaaggccacgatgatgaag
gtctccgacccgatcgtcttcggccacgtcgtgcgcgccttcttcccgaagaccttcgcg
cagtacggcgaggcgctggcgagtgccgggctgaccccgaacgacggcctcggcggcatc
tacaagggcctggaggccctgccgaacggcgccgagatcaaggcgtccttcgacgccgag
ctggccgcgggcccggagctggcgatggtcgactccgaccgcggcatcaccaacctgcac
gtccccagcgacgtcatcgtcgacgcgtcgatgccggccatgatccgcacctccggccac
atgtggggcccggacggcgaggaggccgacaccctcgcggtgctccccgacagcagctac
gccggcatctaccaggccgtcatcgacgactgccgggcgcacggcgcgttcgacccggcc
accatgggctcggtgccgaacgtcggcctgatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatcccggtcaccggcacggtgcgggtcctcgacggtgcgggc
aacgccgtcctggagcagaccgtgggcgccggcgacatcttccggatgtgccagaccaag
gacgcgccgatcaaggactgggtcaagctcgccgtcacccgcgcccgcgccaccggtgac
ccggcggtgttctggctcgacgcgacccgcgcgcacgacgcccagctgatcgagaaggtc
aaggcgtacctgccggagcacgacaccgagggcctggagatcaagatcctcgccccggtc
gaggcgatcaccttctccctggagcgcatccgccgcggcgaggacaccatctcggtgacc
ggcaacgtcctgcgcgactacctgacggacctgttcccgatcctggagctgggcaccagc
gccaagatgctctcggtcgtcccgctgatgaacggcggcggcctgttcgagaccggcgcc
ggcggctccgcgcccaagcacgtccagcagctggtcaaggagaactacctgcgctgggac
agcctcggcgagttcctcgcgctcgcggtgagcttcgagcacctggcgacgaccacgggc
aacgcccgcgcccaggtcctcgccgacaccctggaccgtgcgaccggctcgttcctgaac
gagaacaagtcgccgagccgcaagctgggtggcatcgacaaccgcggcagccacttctac
ctggcgctgtactgggcccaggagctggccaagcagaccgacgacgcgcagctcgcggag
gcgttcgggccgctggccaagacgctggccgagcaggagcaggccatcgtcgacgagctg
atcgcggtgcagggctccccggccgacatcggtggctactaccgccccgacgcggccaag
gcgtccgcggtgatgcgtccgtcgaagacgctgaaccaggcgctcgcggccctcaagggc
tga

DBGET integrated database retrieval system