KEGG   Streptomyces albulus ZPM: SAZ_15390Help
Entry
SAZ_15390         CDS       T03896                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
sall  Streptomyces albulus ZPM
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AKA03679
LinkDB All DBs
Position
complement(3513972..3515423)
Genome map
AA seq 483 aa AA seqDB search
MGDLVEHGKLYIGGEWVDPAGPDTIEVVSPHTERVIGRVPHAARADVDRAVAAARASFAS
GVWADAPLDERIAVVTRIKDAFAVRSEEFARVIGAQNGTPVTSGVMVQSLAAMMVWDATL
TVAREFAFEERRAGALGPLLVRREPVGVVAAVVPWNVPQFTAAAKLAPALLAGCSVVLKV
SPETPLDAYLLAEIASEAGVPPGVLSILPADREVSEYLVGHPGVDKVSFTGSVAAGRRVM
EVAARNLTRVTLELGGKSAAVILPDADLDAAVAGIAPFAWMINGQACVAQTRILAPRSRY
DEIAERFAAAAGALVVGDPLDPATELGPLVARRQQQRSLDYIALGQQEGAKVLAGGGRPK
GQSTGWYVEPTLFGEVDNGMRIAREEIFGPVICLLPYGDEAEAVRIANDSEYGLSGSVWT
ADTDRGIDLARRVRTGTYSVNTFSIDMLGPFGGYKNSGIGREFGPEGFAEYLEHKMIHLP
AGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacctcgtcgagcacggaaagctctacataggcggtgagtgggtcgatccggcc
ggaccggacacgatcgaggtcgtctcgccgcacaccgaacgggtcatcggacgggtcccg
cacgccgcgcgggccgacgtcgaccgggcggtggccgcggcccgggcgtccttcgcgtcc
ggggtgtgggccgatgccccgctggacgagcggatcgcggtggtgacccgcatcaaggac
gcgttcgcggtgcgcagcgaggagttcgcgcgggtcatcggcgcgcagaacgggacgccg
gtcacctcgggcgtgatggtgcagtcgctggccgcgatgatggtgtgggacgcgacgctc
accgtggcgcgggagttcgccttcgaggagcggcgggccggggcgctggggccgctgctg
gtgcgccgcgagccggtgggggtggtcgcggccgtcgtgccctggaacgtcccgcagttc
accgccgccgccaaactcgcgccggcgctgctggccgggtgctcggtggtgctgaaggtc
tcgccggagaccccgttggacgcgtacctgctcgcggagatcgcctcggaggccggcgtg
ccgccgggggtgctgtcgatcctgccggccgaccgggaggtcagcgagtacctggtcggg
catccgggcgtggacaaggtgtcgttcaccggctcggtggcggccggcaggcgggtcatg
gaggtcgccgcccgcaacctcacccgggtgacgctggagttgggcggcaagtcggcggcg
gtgatcctgccggacgcggacctggacgcggcggtggccggcatcgcgccgttcgcgtgg
atgatcaacggccaggcgtgcgtggcgcagacccggatcctcgcgccgcgcagccgttac
gacgagatcgccgagcggttcgcggcggcggcgggcgcgctcgtcgtcggcgatccgctg
gacccggccacggaactcggaccgctggtcgcccgccgtcagcagcaacgctccctggac
tacatcgcgttgggccagcaggagggcgccaaggtgctggccggcggcggccgcccgaag
gggcagtcgaccgggtggtacgtcgagccgacgctcttcggggaggtcgacaacgggatg
cggatcgcccgggaggagatcttcggcccggtcatctgcctgctgccgtacggggacgag
gcggaggcggtgcggatcgccaacgactcggagtacgggctgtcgggctcggtgtggacc
gcggacaccgaccgcggcatcgacctcgcgcgacgggtgcgcaccgggacgtactcggtg
aacaccttcagcatcgacatgctcggtccgttcggcggctacaagaactccggcatcggc
cgggagttcgggcccgaggggttcgccgagtacctggagcacaagatgatccacctgccg
gcgggtgcctga

DBGET integrated database retrieval system