KEGG   Streptomyces albulus ZPM: SAZ_16985Help
Entry
SAZ_16985         CDS       T03896                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K14949  serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
sall  Streptomyces albulus ZPM
Brite
KEGG Orthology (KO) [BR:sall00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sall01001]
    SAZ_16985
Enzymes [BR:sall01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SAZ_16985
Protein kinases [BR:sall01001]
 Serine/threonine kinases: Other
  Bacterial family
   SAZ_16985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknG_TPR PknG_rubred Pkinase Pkinase_Tyr TPR_19 TPR_16 DZR
Motif
Other DBs
NCBI-ProteinID: AKA03959
LinkDB All DBs
Position
3876812..3879406
Genome map
AA seq 864 aa AA seqDB search
MTERDGGRCQRRECAGHYEDVGGGELYCEVCGLAPVVSPEGLLSATATVLTERMDLGDAT
VAGPAPSGGGRGRRPDGAHAPGRASGAGSGSGGRTSPVVHGSGSGRPGSGSGSGGGSGAS
RGRLGAGLVSVPQVPRRDPLAAVLTDPEVPERKRFCSRGECGAPVGRGRDGRPGTAEGFC
TRCGHPYSFVPKLRAGELVHDQYEVAGCLAHGGLGWIYLARDRAVDDRWVVLKGLLDTGD
EEALAAAVSERRYLAAIEHPNIVRIYNFVEHLDRSTGSRDGYIVMEYVGGTSLKDLANER
RTAHGRRDPMPVEQACAYGIEALEALGHLHGRQLLYCDFKVDNAIQQHDRLKLIDLGAVR
RADDHESPLFGTIGYQAPEVGEVGPSVASDLYTVARTLAVLTFDFQGYTNVFADSLPDPD
HIEVFRSYESFYRLLVRATDPDPGRRFGSAEEMAEQLTGVLREVVALRTGEPRPAPSTLF
GPELRVVGTEPMPPPDGDASLLGGRRTGRGRGRRPAGADPVRPVGGPQPRPLDAAGAALA
LPVPRVDPDDPQAGFLASLHAATPAELLAALRAAPADSPEVRLRALRAQLELGRGAADPQ
PDAPDAGERWDVGGPPDGAGDWRTVWHRGLVALATGDREGAALAFDAVYDAFPGEPAPKL
ALGISAELLGQLDNAAEYYRLVWATDRGYVSAAFGLARVRLAAGDRTGAVAALESVPEAS
IHYTAARIAAVRARLRQRSPREPLLADLTAAAQQVQALADFGLDDRRRELLATEVLGSAL
DWVLSGGHGDGPPAGTPGDGGSGGTAGPPTAHQRPALLGSPLDERGLRFGLERSYRLLAR
LAQRGEERIELVERANRFRPRTWV
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
gtgacggaacgggacggggggcggtgccagcgccgggagtgcgcggggcactacgaggac
gtcggcggcggggaactgtactgcgaggtgtgcgggctggcgccggtggtgtcccccgag
gggctgctgtcggcgaccgcgacggtgctgacggagcggatggacctcggggacgcgacg
gtcgccgggccggcgccgtccgggggcggtcggggacgccggccggacggggcgcacgcg
ccggggcgggcttcgggggccggcagcgggtcgggcggacggacgtcgccggtggtgcac
ggttccggcagcggccggccgggctcgggttcgggttcggggggcggttccggggcgtcg
cgcggccggttgggggccgggctggtgtcggtgccgcaggtgccgcggcgcgatccgctg
gcggcggtgctgaccgatccggaggtgccggagcggaagcggttctgcagccgcggggag
tgcggggcgccggtgggccggggccgggacgggcgtccgggcacggcggagggcttctgc
acccggtgcggccatccgtacagcttcgtgccgaagttgcgggccggggagctggtgcac
gaccagtacgaggtcgcggggtgcctggcgcacggcgggctgggctggatctacctcgcg
cgggaccgggcggtcgacgaccggtgggtggtgctcaaggggctgctggacaccggtgac
gaggaggcgctggcggcggcggtgtccgagcgacggtacctggcggcgatcgagcacccc
aacatcgtgcggatctacaacttcgtggagcacctggaccgttcgacgggcagccgggac
ggctacatcgtcatggagtacgtcggcggcacgtcgttgaaggacctcgccaacgagcgg
cgcaccgcccacgggcggcgcgatccgatgccggtggagcaggcgtgcgcgtacggcatc
gaggcgctggaggcgctcggccacctgcacggccggcagttgctgtactgcgacttcaag
gtcgacaacgccatccagcagcacgaccggctgaagctgatcgacctgggtgcggtgcgg
cgggcggacgaccacgagagcccgctgttcgggacgatcggctaccaggcgccggaggtc
ggcgaggtggggccgtcggtcgcctccgacctgtacaccgtcgcgcgcaccctcgccgtc
ctcaccttcgacttccaggggtacaccaacgtcttcgcggactcgctgccggacccggac
cacatcgaggtgttccgctcctacgagtcgttctaccggctgctggtgcgggccaccgac
ccggacccggggcggcggttcgggtccgcggaggagatggccgagcagttgacgggcgtg
ctgcgggaggtggtggcgctgcggacgggcgagccgcggccggcaccgtcgacgcttttc
gggcccgagctgcgggtggtgggcaccgagccgatgccgccgccggacggggacgcctcg
ctgctgggcggccgccggaccggccggggacgcgggcggcggccggccggggcggatccg
gtgcgaccggtcggcgggccgcagccgcgccccctcgacgcggcgggggcggcgctggcg
ctgccggtgccgcgggtcgatccggacgacccccaggccgggttcctggcctccctgcac
gccgcgaccccggcggagctgctggccgcgctgcgggcggcgccggccgactcgccggag
gtccggctgcgggccctgcgcgcccaactggagctggggcggggcgcggcggacccgcag
ccggacgcgccggacgccggggagcggtgggacgtcggcgggccgccggacggggccggg
gactggcggacggtgtggcaccgcgggctggtggcgctggccaccggcgaccgggagggc
gcggcgctcgccttcgacgcggtctacgacgcctttccgggtgaaccggcgccgaagctg
gcgctgggcatcagtgccgaactgctggggcagttggacaacgccgcggagtactaccgc
ctcgtgtgggcgaccgaccgcggatacgtgagtgccgcgttcgggctggcccgggtgcgg
ttggcggccggtgaccggacgggtgcggtggcggccctggagtccgtgccggaggcgtcc
atccactacacggcggcccggatcgccgcggtccgggcccggctgcggcagcgctcgccc
cgggaaccgctgctggcggacctgacggccgccgcccaacaggtgcaggcgctcgccgac
ttcggactggacgaccggcggcgggaactcctcgccaccgaagtactgggcagtgccctg
gactgggtactctccggaggccacggcgacgggccaccggccggcacccccggtgacggg
gggtcgggcggcactgccgggccgccgaccgcgcaccagcggccggcgctgctcggcagc
ccgttggacgaacgcgggctgcggttcgggctggagcgttcgtaccgcctgctggcgcgc
ctcgcgcagcgtggcgaggaaaggatcgagctggtggagcgggccaaccgcttccgcccc
aggacatgggtgtga

DBGET integrated database retrieval system