KEGG   Streptomyces albulus ZPM: SAZ_18155Help
Entry
SAZ_18155         CDS       T03896                                 

Definition
(GenBank) serine/threonine-protein kinase
Organism
sall  Streptomyces albulus ZPM
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AKA04160
LinkDB All DBs
Position
complement(4147204..4148829)
Genome map
AA seq 541 aa AA seqDB search
MRPVGSKYLLEEPLGRGATGTVWRARQRETAGAEAAVPGEPGETVAIKVLKEELASDADV
VMRFLRERSVLLRLTHPNIVRTRDLVVEGDLLALVMDLVDGPDLHRYLRDNGPFSAVAAA
LLTAQIADALAASHADGVVHRDLKPANVLLAGSDGSGEMHPMLTDFGIARLADSPGLTRT
HEFVGTPAYVAPESAEGRPQTSAVDVYGAGILLYELVTGRPPFAGATALEVLHKHLAEEP
QRPASVPDPMWTVIERCLRKRPEERPSAENLARGLRTVAAGVGEQATPEQAQAALGVAAL
LAPDPDPATVPGTEGSQVSGAAAPTQVLPTNASSYDPGAPTSVLPATGAGGPAGQGPAPT
RAMPPVPPMPMGSPAGPPEPEGPHPWESQLRAARDRNDQTQVQYLDPQDDPLRRRPQRRP
GPAPQQQPQYGGQPAGYAAQRPPAPQRRQEPPPQRYEPPPPPAREPRPPREPRQRSANPM
RIPGLGCLKGCLFTLLLLFVAAWLVWEFTPLQEWIGTTKGFFQQIGDVFTSVKDFVQKVG
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
gtgcggccggtaggcagcaagtacctgcttgaggagccgctgggacgcggcgccacgggc
accgtctggcgtgcccgccagagggagacggcgggtgccgaggccgccgtcccgggggag
cccggcgaaacggtcgcgatcaaggtcctcaaggaggagctggcgtccgacgccgacgtg
gtgatgcgcttcctgcgggagcgctccgtcctgctgcggctcacccaccccaacatcgtc
cggacccgcgacctggtcgtcgagggcgacctgctggcgctcgtcatggacctggtcgac
ggccccgacctgcaccgctacctgcgcgacaacggcccgttcagcgcggtggcggcggcg
ctgctcaccgcgcagatcgccgacgcgctggccgccagccacgccgacggcgtcgtccac
cgcgacctcaagcccgccaacgtcctgctcgccggctcggacggcagcggcgagatgcac
ccgatgctgaccgacttcggcatcgcccggctcgccgattcccccgggctgacccggacg
cacgagttcgtcggcacccccgcctacgtggcgccggagtccgccgaggggcgcccgcag
acctccgcggtggacgtctacggcgccggcatcctgctctacgagctggtcaccggccgt
ccgccgttcgccggggcgaccgccctggaggtcctgcacaagcacctcgccgaggagccg
cagcgccccgcctcggtccccgacccgatgtggacggtcatcgagcggtgcctgcgcaag
cgccccgaggagcgccccagcgccgagaacctcgcccgcgggctgcgcaccgtcgcggcg
ggcgtcggcgagcaggccaccccggagcaggcccaggcggcgctgggcgtcgccgcgctg
ctcgccccggacccggaccccgccacggtccccggcaccgagggctcccaggtgtcgggc
gccgcggcgcccacccaggtgctgccgaccaacgcgtcctcctacgacccgggcgccccg
accagcgtgctgccggccaccggcgccggtggccccgcgggccagggcccggcgccgacc
cgcgcgatgccgccggtgcccccgatgccgatggggtcgcccgccggcccgccggagccc
gagggtccgcacccgtgggagtcccagctgcgggctgcccgcgaccgcaacgaccagacc
caggtgcagtacctggacccgcaggacgacccgctgcgccgccgcccgcagcgtcgcccg
gggcccgccccgcagcagcagccccagtacggcggccagccggccggctacgccgcgcag
cggccgccggccccgcagcgccgccaggagccgccgccgcagcgctacgagccgcccccg
ccgcccgcccgggagccccggcccccgcgcgagccgcgccagcgcagcgccaacccgatg
cggatccccggcctgggctgcctgaagggctgcctcttcacgctgctgctgctgttcgtg
gcggcctggttggtctgggagttcaccccgctccaggagtggatcgggacgaccaagggc
ttcttccaacagatcggtgacgtcttcaccagcgtgaaggacttcgtacagaaagtcggt
ggctga

DBGET integrated database retrieval system