KEGG   Streptomyces albulus ZPM: SAZ_18990Help
Entry
SAZ_18990         CDS       T03896                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sall  Streptomyces albulus ZPM
Pathway
sall00620  Pyruvate metabolism
sall00680  Methane metabolism
sall01100  Metabolic pathways
sall01120  Microbial metabolism in diverse environments
sall01200  Carbon metabolism
Module
sall_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sall00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAZ_18990
  09102 Energy metabolism
   00680 Methane metabolism
    SAZ_18990
Enzymes [BR:sall01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SAZ_18990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AKA04305
LinkDB All DBs
Position
complement(4368288..4371053)
Genome map
AA seq 921 aa AA seqDB search
MSSADNNPAESTTPGTTQGTSGDNGALRADIRRLGDLLGETLVRQEGQDLLDLVEQVRAL
TRSDGEAAARLLGETDLITAAKLVRAFSTYFHLANVTEQVHRGRELRARRASEGSILART
ADMLKDADPEHLRATARNLGVRPVFTAHPTEAARRSVLTKLRKIAELLDRTDAADRRRVD
LRLAESVDLIWQTDELRVARPEPTDEARNAIYYLDELGRGAVGDVLEDLAAELERAGTEL
PAGTRPLTFGTWIGGDRDGNPNVTPQVTWDVLILQHEHGISDALEHVDELRGALSNSIRN
CGATDELLASLQQDLDLLPEISPRYKRLNSEEPYRLKATCIRQKLLNTRDRLAGDTPHVP
GRDYLGTSELLDDLALIQTSLRAHRGGLIADGRLERTLRTISAFGLQLATMDVREHADAH
HHALGQLFDRLGEESWRYVDMPRDYRRKLLAKELRSRRPLAPTPPPLDEAGAKTLGVFRT
IRRAKKTFGPEVIESYIISMCQGSDDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETTDE
LKIADQLLDDMLSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRLLRDV
AHRHGVRLRLFHGRGGTVGRGGGPSHDAILAQPYGTLEGEIKVTEQGEVISDKYLVPSLA
RENLELTVAATLQASALHTAPRQSDEALARWDAAMETVSDAAHGAYRRLVEDPDLPAYFF
ASTPVDQLADLHLGSRPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWFGVGTGLKAAR
EAGLDTVLDEMHAHWHFFRNFLSNVEMTLAKTDLRIAEHYVDTLVPEELQHVFAVIKAEH
ELTVAEVLRITGETELLDSNPVLKQTFRVRDAYLDPISYLQVSLLKRQRDAAAADQQPDP
LLSRALLLTVNGVAAGLRNTG
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacaacaaccccgccgagtccaccacccccgggaccacccagggcacc
agcggtgacaacggtgccctgcgcgccgacatccgccgcctcggcgacctcctcggcgag
accctcgtccggcaggagggccaggacctcctcgacctcgtggaacaggtccgcgccctg
acccgctccgacggcgaggccgccgcccggctcctgggcgagaccgacctgatcaccgcc
gccaagctggtccgcgccttctccacgtacttccacctcgccaacgtcaccgagcaggtc
caccgcggtcgcgagctccgcgccaggcgcgcctccgagggcagcatcctggcccgcacc
gccgacatgctcaaggacgccgaccccgagcacctgcgggccaccgcccgcaacctcggc
gtccgcccggtcttcaccgcccacccgaccgaggccgcccgccgctccgtgctcaccaag
ctccgcaagatcgccgagctgctggaccgcaccgacgccgccgaccgccgccgcgtcgac
ctccgcctcgccgagagcgtcgacctcatctggcagaccgacgaactccgcgtcgcccgg
cccgagcccaccgacgaggcgcgcaacgccatctactacctcgacgagctcggccgcggc
gccgtcggcgacgtcctcgaagacctcgccgccgaactcgagcgcgccggcaccgaactc
cccgccggcacccgcccgctgaccttcggcacctggatcggcggcgaccgcgacggcaac
cccaacgtcaccccgcaggtgacctgggacgtgctgatcctccagcacgagcacggcatc
agcgacgccctggagcacgtcgacgaactccgcggcgccctctccaactccatccgcaac
tgcggcgccaccgacgagctgctcgcctcgctccagcaggacctcgacctcctcccggag
atcagcccccgctacaagcgcctcaacagcgaagagccctaccgcctgaaggcgacctgc
atccggcagaagctcctcaacacccgcgaccgcctcgccggcgacaccccgcacgtgccg
ggccgcgactacctcggcaccagcgagctcctcgacgacctcgccctcatccagacctcg
ctgcgcgcccaccgcggcggcctgatcgccgacggccgcctcgaacgcaccctgcgcacc
atctccgcgttcggcctccagctcgccaccatggacgtccgcgagcacgccgacgcccac
caccacgccctcggccagctcttcgaccgcctcggcgaggagtcctggcgctacgtggac
atgccgcgcgactaccggcgcaagctgctcgccaaggaactccgctcccggcggccgctg
gcccccaccccgccgcccctcgacgaggccggcgccaagaccctcggcgtcttccgcacc
atccgccgggccaagaagaccttcggccccgaggtcatcgagtcctacatcatctcgatg
tgccagggctccgacgacgtcttcgccgcggccgtcctggcccgcgaggccggcctgatc
gacctgcacgccggctgggccaagatcggcatcgtgccgctgctggagaccaccgacgag
ctgaagatcgccgaccagctcctcgacgacatgctctccgacccctcctaccgccgcctc
gtggccctgcgcggcgacgtccaggaggtcatgctcggctactccgactcctcgaagttc
ggcggcatcaccaccagccagtgggagatccaccgcgcccagcgcctgctccgcgacgtc
gcgcaccgccacggcgtgcgcctgcgcctcttccacggccgcggcggcaccgtcggtcgc
ggcggcggcccctcgcacgacgcgatcctcgcccagccctacggcaccctcgaaggcgag
atcaaggtcaccgagcagggcgaggtcatctccgacaagtacctcgtcccgtcactcgcc
cgggagaacctcgaactgaccgtcgccgcgacgctccaggcatccgccctgcacaccgcg
ccccgacagtccgacgaggccctggcccgctgggacgcggccatggagaccgtctccgac
gccgcccacggcgcctaccgccgcctcgtcgaggacccggacctgcccgcgtacttcttc
gcctccacccccgtggaccagctcgccgacctccacctcggctcgcggccctcccgccgc
cccgactccggcgccggcctcgacggcctccgcgccatcccgtgggtgttcggctggacc
cagtcccggcagatcgtccccggctggttcggcgtcggcaccgggctcaaggccgcccgc
gaagccggcctcgacacggtcctggacgaaatgcacgcgcactggcacttcttccgcaac
ttcctctccaacgtcgagatgacgctggccaagacggacctgcggatcgccgagcactac
gtcgacaccctcgtccccgaagagctccagcacgtcttcgccgtcatcaaggccgaacac
gagctcaccgtcgccgaggtcctgcgcatcaccggcgagaccgaactcctcgactccaac
ccggtgctcaagcagaccttccgcgtccgcgacgcctacctcgacccgatctcctacctc
caggtctccctcctcaagcgccagcgcgacgcggccgccgccgaccagcagcccgacccg
ctgctctcccgcgccctgctcctgaccgtcaacggcgtggcggccggcctgcgcaacacc
ggctga

DBGET integrated database retrieval system