KEGG   Streptomyces albulus ZPM: SAZ_19020Help
Entry
SAZ_19020         CDS       T03896                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
sall  Streptomyces albulus ZPM
Brite
KEGG Orthology (KO) [BR:sall00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SAZ_19020
Enzymes [BR:sall01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SAZ_19020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 DUF4350 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: AKA04311
LinkDB All DBs
Position
4375910..4377964
Genome map
AA seq 684 aa AA seqDB search
MGIRFGGDYNPEHWPEEVWAEDLALMKAAHVSMVTAGIFSWAKVEPRPGEWDFGWFDRVM
DGLAGAGIAVCLATMTASPPPWLSRAHPEILPEGPDGQRRWPGARQHFCPSSPVFRAHAV
RLVEQVAARYADHPALALWHVGNEFGCHTRQCFCDVSAEHFRSWLRERYGSVAALNDAWS
TSFWSQAYGDFAEVLPPRTAPTFANPAQQLDYLRFGDAALRECYLAERAVLTRLAPGVPV
TTNLMPQHKPVDAFGWAPSMDVMALDFYQDPHVPDDHVRAAYVFDLMRSAREGQPWLLLE
QAPGAVNWRPRNGPKPPGAMRLWSWQAVAQGADAVLFFQWRQSLGGAEKFHSAMVPHGGT
DTRIFREVCALGRELAAVPGIEGARSRASVALLADWQSWWALELDSRPSTALDHSRIALA
HYRPLFEAGVACDVVPPGRELSGYRMVVVPNLYLLTDRDAARLAAYVRGGGQLVVSFFSG
IVDDCDRVRPGGYPGPLRELLGLRVTEFWPLAEGRSVAVGDGDPTAAGRGRQTGRAYAGR
ADLWSEEIEVAGAEVVARFLDGELAGQPAVTRHDHGRGTAWYVGTRLEPALMRALLDDVR
AAAGVAPVLPDLPPGVQATVREGAGGRYVFLLNHGGRAVEVALPEPLRDAWEPRAAAVTR
VTLAARGVAVLTGPEREGGGGAPE
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgggcatccgattcggcggcgactacaaccccgagcactggccggaggaggtgtgggcc
gaggacctggcgctgatgaaggcggcccacgtctccatggtcacggccgggatcttctcc
tgggcgaaggtcgaaccccggccgggggaatgggacttcggctggttcgaccgggtcatg
gacggcctggccggggccgggatcgcggtgtgtctggcgacgatgacggcgtcaccgccc
ccgtggttgagccgggcgcacccggagatcctgccggagggcccggacgggcagcgccgc
tggccgggcgcgcggcagcacttctgcccgtccagcccggtgttccgggcgcacgcggtg
cggctggtggaacaggtcgcggcgcggtacgccgaccatccggcgctcgcgctgtggcac
gtgggcaacgagttcgggtgtcacacccggcagtgcttctgcgacgtgtcggcggagcac
ttccggagctggctgcgggagcggtacggcagcgtggcggcgctcaacgacgcctggtcg
acgtcgttctggtcgcaggcgtacggggacttcgcggaggtgctgccgccccggaccgcg
ccgacgttcgccaatccggcgcagcagttggactacctgcggttcggtgacgcggcgctg
cgggagtgctatctggcggagcgggcggtgctcacgcggctggcgcccggggtgccggtg
acgacgaacctgatgccgcagcacaagccggtggacgcgttcggttgggcgccgtcgatg
gacgtgatggcgctggacttctaccaggacccgcacgtgccggacgaccacgtccgggcg
gcctacgtcttcgacctgatgcggtcggcgcgcgaggggcagccgtggctgttgctggag
caggcgcccggcgcggtcaactggcggccgcgcaacgggcccaagccgcccggggcgatg
cggctgtggagctggcaggcggtggcgcagggcgcggacgcggtgctgttcttccagtgg
cggcagtcgctgggcggggcggagaagttccactcggcgatggtgccgcacggcgggacg
gacacccggatcttccgtgaggtgtgcgcgctggggcgggagttggcggcggtgccgggg
atcgagggggcccggtcgcgggcctcggtggcgctgctggccgactggcagagctggtgg
gcgctggagctggattcccggccgtccacggcgctggaccactcccggatcgcgctggcc
cactaccggccgctgttcgaggcgggggtggcctgcgacgtggtgccgccgggacgggag
ttgtcggggtaccggatggtggtggtgccgaacctgtacctgctgacggaccgggacgcg
gcgcggctggcggcgtacgtgcgcggtggcgggcagctggtggtgtcgttcttctccggc
atcgtcgacgactgcgaccgggtgcgtccggggggctacccggggccgttgcgggagttg
ctggggttgcgggtgacggagttctggccgctggccgagggacggtcggtggcggtgggc
gacggcgatccgaccgcggccgggcggggccggcagaccgggcgggcctacgccggtcgc
gcggacctgtggtcggaggagatcgaggtggccggcgccgaggtggtggcgcggttcctc
gacggcgagctggccgggcagccggcggtgacccggcacgaccacgggcggggcacggcc
tggtacgtcgggactcggctggaaccggccctgatgcgggccctgttggacgacgtgcgg
gcggcggcgggcgtggcgccggtgctgccggacctgccgccgggcgtgcaggcgacggtg
cgggagggcgccggcggccggtacgtgttcctgctgaaccacggcggccgggcggtggag
gtggcactgccggagccgctgcgggacgcgtgggagccccgggcggcggcggtgacgcgg
gtgacgctggccgcccggggcgtggcggtgctgaccggtccggaacgggagggcggtggg
ggcgccccggagtga

DBGET integrated database retrieval system