KEGG   Streptomyces albulus ZPM: SAZ_24330Help
Entry
SAZ_24330         CDS       T03896                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sall  Streptomyces albulus ZPM
Pathway
sall00250  Alanine, aspartate and glutamate metabolism
sall00410  beta-Alanine metabolism
sall00430  Taurine and hypotaurine metabolism
sall00650  Butanoate metabolism
sall01100  Metabolic pathways
sall01110  Biosynthesis of secondary metabolites
sall01120  Microbial metabolism in diverse environments
sall02024  Quorum sensing
Module
sall_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sall00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAZ_24330
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAZ_24330
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAZ_24330
   00430 Taurine and hypotaurine metabolism
    SAZ_24330
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAZ_24330
Enzymes [BR:sall01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SAZ_24330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AKA05222
LinkDB All DBs
Position
complement(5529644..5531059)
Genome map
AA seq 471 aa AA seqDB search
MPLHNGDAERPRDHRRHPVNPFYGEADPVAGMETSPPVHALPDGPISPHNAYQFVHDELM
LDGNARLNLATFVTTWMEPQATVLMSECRDKNMIDKDEYPRTAELERRCVAMLANLWHAP
DPSAIMGCSTTGSSEACMLAGMALKRRWARRNQDRYPGTARPNLVMGANVQVCWEKFCNF
WEVEARQVPMEGDRFHLDADSAAALCDENTIGVVAVLGSTFDGSYEPVAEICGALDALQE
RTGLDVPVHVDGASGAMVAPFLDPELVWDFRLPRVASINTSGHKYGLVYPGVGWALWRNQ
EALPEELVFRVNYLGGDLPTFALNFSRPGAQVAAQYYTFLRLGRDGYRAVQQVTRDVARS
MAERIGALGDFRLLTRGDQLPVFAFTTADDVTSFDVFDVSRRLKERGWLVPAYTFPPNRQ
DLSVLRVVCRNGFSLDLADTFLADLEELLPELRRQPAPLGRPENVATAFHH
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcacaacggcgacgccgaacgcccccgcgaccaccggcggcacccggtcaac
cccttctacggcgaggccgacccggtcgccgggatggagacctctcccccggtgcacgcc
cttcccgacggcccgatctccccccacaacgcctaccagttcgtccacgacgagctgatg
ctggacggcaacgcccggctcaacctcgccaccttcgtcaccacgtggatggagccgcag
gccaccgtcctgatgtcggagtgccgcgacaagaacatgatcgacaaggacgagtacccg
cgcaccgccgaactggagcggcgctgcgtggcgatgctcgccaacctctggcacgccccc
gacccgagcgccatcatgggctgctccaccaccggctccagcgaggcgtgcatgctcgcc
ggcatggctctcaagcgccgctgggccaggcgcaaccaggaccgctatcccggcaccgcc
cggccgaacctcgtcatgggcgccaacgtccaggtctgctgggagaagttctgcaacttc
tgggaggtcgaggcccgccaggtccccatggagggcgaccgcttccacctggacgcggat
tccgccgccgcgctctgcgacgagaacaccatcggcgtcgtcgccgtcctcggctcgacc
ttcgacggctcctacgagccggtggcggagatctgcggggcgctcgacgcgctccaggaa
cgcaccggcctggacgtccccgtccacgtggacggcgcctctggcgcgatggtcgcgccg
ttcctcgaccccgagctggtgtgggacttccgcctcccccgggtcgcctcgatcaacacc
tccggccacaagtacggcctggtctacccgggcgtcggctgggcgctctggcgcaaccag
gaggcgctccccgaggaactggtcttccgcgtcaactacctgggcggcgacctccccacc
ttcgcgctcaacttctcccgccccggcgcccaggtcgccgcccagtactacacgttcctg
cggctgggccgggacggctaccgcgccgtccagcaggtcacccgcgacgtggcccgctcg
atggccgaacggatcggtgcgctgggcgacttccggctgctcacccgcggcgaccaacta
ccggtcttcgccttcaccaccgccgacgacgtcacgtccttcgacgtcttcgacgtgtcc
cggcggttgaaggagcgcgggtggctggtccccgcctacaccttcccgcccaaccgccag
gacctctccgtcctgcgggtggtctgccgcaacggcttctccctggacctggccgacacc
ttcctggccgacctggaggagctgctccccgaactccgccggcagccggccccgttgggc
cgtccggagaacgtcgccaccgccttccaccactga

DBGET integrated database retrieval system