KEGG   Streptomyces albulus ZPM: SAZ_35570Help
Entry
SAZ_35570         CDS       T03896                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
sall  Streptomyces albulus ZPM
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N AlaDh_PNT_C GFO_IDH_MocA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AKA07125
LinkDB All DBs
Position
complement(8093597..8094610)
Genome map
AA seq 337 aa AA seqDB search
MRAVVIEEPHRLDVTTVPDPTPGPGEVVVKVAAAGLCGTDVHMLAGEFGPTRYPVIPGHE
FAGEVVAVGADVTEFAQGDAVAADPAIYCGACHFCAIGRGNLCERWGTIGITQDGACAEY
VAVPVRNCYRLPEGVSLAHAPLIEPLSTIVRGFDLVAPKLGDNFLIYGAGTMGLLYLQVA
QRSGAASVSVVDVNEDRLAVARKLGADAVATHADALADAHPRGWEVVTDCTGNIRAIEDG
LTRPARGGTFQQFGCAPDQESARFSPFRIYNDEIRIVGSMAILHSYGRAVELLGKGVIDA
ETMITHRFGLDGYATALETFRQGTGRKLQIVPNGPVD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagtagtcatcgaggaaccgcaccggctcgacgtcaccaccgtcccggacccg
acgcccggccccggcgaggtcgtcgtcaaggtcgcggcggcggggctgtgcgggaccgac
gtgcacatgctggcgggcgagttcgggccgacccgctatccggtgatacctgggcacgag
ttcgccggtgaggtggtcgcggtcggcgcggacgtcacggagttcgcccagggcgacgcc
gtcgccgccgatccggcgatctactgcggcgcgtgtcacttctgcgccatcggccgcggc
aacctctgcgagcgctggggcaccatcggcatcacccaggacggcgcctgcgcggagtac
gtcgcggtgccggtccgcaactgctaccggctgccggagggcgtgtcgctggcgcacgcg
ccgctgatcgaaccgctgtcgacgatcgtgcgcggcttcgacctcgtggcccccaagctc
ggcgacaacttcctcatctacggcgccggcaccatgggcctgctctacctccaggtcgcc
cagcgctccggcgccgcctcggtctcggtcgtggacgtcaacgaggaccggctcgcggtg
gcccgcaagctcggtgcggacgccgtcgccacccacgccgacgcgctggccgacgcgcac
ccgcgcggctgggaggtggtcaccgactgcaccggcaacatccgcgccatcgaggacggc
ctgacccggccggcccgcggcggcaccttccagcagttcggctgcgcgcccgaccaggag
agcgcgcgattctcgccgttccggatctacaacgacgagatccggatcgtcggcagcatg
gcgatcctgcacagctacggccgcgcggtggaactgctcggcaagggcgtcatcgacgcc
gagacgatgatcactcaccggttcgggctggacgggtacgccaccgccctggagaccttc
cgacagggcaccggccgcaagctccagatcgtcccgaacggcccggtggactga

DBGET integrated database retrieval system