KEGG   Streptomyces albulus ZPM: SAZ_36050Help
Entry
SAZ_36050         CDS       T03896                                 

Definition
(GenBank) glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sall  Streptomyces albulus ZPM
Pathway
sall00500  Starch and sucrose metabolism
sall01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sall00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAZ_36050
Enzymes [BR:sall01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SAZ_36050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C DUF3104 SpoU_methylas_C
Motif
Other DBs
NCBI-ProteinID: AKA07210
LinkDB All DBs
Position
8204563..8205972
Genome map
AA seq 469 aa AA seqDB search
MQRRRSRDHAATGRPHRRPRTRALGGLLAAVGLTALAPWPAQATPPGDRTVTATLFEWKY
ADVARACTDQLGPAGYGYVEVSPASEHIQGDQWWTSYQPVSYKIAGRLGDRAAFAAMVGS
CHAAGVKVIADAVINHMAAGSGTGTGGTRYTKYTYPGTYQDWDFHGCRRSISDYTNRDDV
QNCELVGLADLDTGSDYVRTTLATYLDDLRSLGVDGFRIDAAKHIAAGDLAAIKGKMKDP
GYWVQEVIHGAGEAVQPDEYTGTGDVDEFRYGTHLKSAFQGRNLAQLKSVADGKLGSDRA
RTFVDNWDTERNGSTLTYKDGATYALANVFMLASPYGSPNVYSGYQWTDKDAGPPASGSS
AWTGEHAKREITGMVGFRNAVGSAELTDWWDNGGDAIAFGRGSAGFVALNAGDGAVNRTF
TTSLPAGTYCDVVAADPSSCDGHTVTVGGDGQAQLTVPAHGAVALHVAR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacgacgaaggagccgcgaccacgcagcgacggggcggccgcaccgccggccccgc
acccgggcgctgggcggactgctggccgccgtcggcctcaccgccctcgccccctggccc
gcacaggccaccccgcccggcgaccggaccgtcaccgccaccctcttcgagtggaagtac
gccgacgtcgcccgggcctgcaccgaccaactgggcccggccggctacggctacgtcgag
gtctcacccgcctccgagcacatccagggcgaccagtggtggacctcgtaccagccggtc
agctacaagatcgccggccggctgggcgaccgcgccgcgttcgccgcgatggtcggcagc
tgccacgccgccggcgtcaaggtcatcgccgacgccgtcatcaaccacatggcggccggc
tccggcaccggtaccggcggcacccggtacaccaagtacacctaccccggcacctaccag
gactgggacttccacggctgccgccggagcatctccgactacaccaaccgcgacgacgtc
cagaactgcgaactggtcgggctcgccgacctcgacaccggcagcgactacgtccgcacc
accctcgccacctacctcgacgacctgcggtccctgggcgtggacggtttccggatcgac
gccgccaagcacatcgccgccggcgacctcgccgccatcaagggcaagatgaaggacccg
gggtactgggtgcaggaggtcatccacggcgccggcgaggcggtccaacccgacgagtac
accggcaccggcgacgtcgacgagttccgctacggcacccacctcaagagcgccttccag
ggccgcaacctcgcccagctcaagtccgtcgccgacggcaagctcggcagcgaccgggcc
cgcacgttcgtcgacaactgggacaccgagcgcaacggctccacgctgacctacaaggac
ggcgcgacctacgccctcgccaacgtcttcatgctcgcctcgccctacggctccccgaac
gtctactccggctaccagtggaccgacaaggacgccggcccgccggcctccggcagctcc
gcctggaccggcgaacacgccaagcgcgagatcaccggcatggtgggcttccgcaacgcg
gtggggtcggcggagctgaccgactggtgggacaacgggggcgacgcgatcgccttcggg
cgcggctccgccgggttcgtcgccctcaacgccggggacggggcggtgaaccggacgttc
accacgtcgttgccggccgggacgtactgcgacgtggtcgccgcggacccgtcttcgtgc
gacgggcacacggtgaccgtgggcggcgacgggcaggcgcagctcaccgtgcccgcccac
ggcgcggtggccctgcacgtcgcccgctga

DBGET integrated database retrieval system