KEGG   Streptomyces albulus ZPM: SAZ_38065Help
Entry
SAZ_38065         CDS       T03896                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
sall  Streptomyces albulus ZPM
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C FANC_SAP
Motif
Other DBs
NCBI-ProteinID: AKA07556
LinkDB All DBs
Position
complement(8623418..8624485)
Genome map
AA seq 355 aa AA seqDB search
MDLPVMPPVSPMLAKPVAKIPAGMQYEAKWDGFRVLVFRDGDEVELASRTTKSLSRYFPE
LLTAVRSELPPRCVLDGEIVIAHDGRLHFEELLERIHPAASRVRTLAARTPASLIAFDLL
ALDSASLLAEPQTARRQALVEALRPARAPVHTAPATTDRELAQRWFGQFEGAGLDGVIAK
PLDLPYRPGERVLYKVKHARTADCVVAGYRLHKSGPVVGSLLLGLHDDAGHLQHVGVCAS
FPMARRRALVEELAPLRMADDETAGHPWGDWADGAAHASRRMPGGPSRWSGGKDLSWVAL
RPELVCEVGYDHMEGSRFRHTAQFRRWRPDRTPGSCTYAQLEEPVGYDLGELLGD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtgatgcccccggtctcccccatgctcgccaaaccggtggcgaagatc
cccgccggaatgcagtacgaggccaagtgggacggcttccgcgtcctcgtcttccgggac
ggcgacgaggtcgaactcgccagccgcaccaccaagtcgctcagccgctacttccccgaa
ttgctgacggcggtccgcagcgaactgccgccgcgctgcgtgctcgacggcgagatcgtg
atcgcgcatgacggccggctgcacttcgaggagctgttggagcgcatccacccggccgcg
tcccgggtgcggacgctggccgcccgcacgcccgcctcgctgatcgccttcgacctgctg
gcgctggactccgcgtcgctgctggccgaaccgcagacggcccgccgccaggccctggtc
gaggcgctgcgtccggcccgggccccggtgcacaccgcgcccgccaccaccgaccgggag
ctggcgcagcggtggttcggccagttcgagggggccggactggacggggtgatcgccaag
cctctggacctgccgtaccggccgggcgagcgcgtgctgtacaaggtcaagcacgcccgc
accgccgactgcgtggtcgccggctaccgcctgcacaagagcgggccggtggtcggctcg
ctgctgctcggactgcacgacgacgcggggcacctccagcacgtcggggtgtgcgcgtcg
tttcccatggcccggcggcgcgccctggtcgaggagctggcgccgctgcggatggccgac
gacgagaccgccggccacccttggggcgactgggcggacggggcggcgcacgcctcccgc
cggatgccgggcggaccgagccgctggagcgggggcaaggacctgtcgtgggtggcgctg
cggccggagctggtgtgcgaggtgggctacgaccacatggagggcagccggttccggcac
accgcgcagttccgccgctggcggcccgaccggacgccggggagctgcacctacgcgcag
ttggaggagccggtcggctacgacctgggggagctgctgggcgactga

DBGET integrated database retrieval system