KEGG   Salinimonas sediminis: D0Y50_08175Help
Entry
D0Y50_08175       CDS       T05624                                 

Definition
(GenBank) MFS transporter
Organism
salm  Salinimonas sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-ProteinID: AXR06343
UniProt: A0A346NLD6
LinkDB All DBs
Position
1818418..1819737
Genome map
AA seq 439 aa AA seqDB search
MNKIISWSVTVAVAGFLFGFDTAVISGADQAIEALWQTSPLVHGLFVMSSALWGTVLGAL
FGNKPCDKLGRKKTLILIGILYLVSALGSAMANDPYIFAALRFIGGVGVGISSIAVPAYI
SEIAPPRMRGRLVAMYQFQIVFGILIAFLSNYLLAGVIVQDWRLMLGIEAVPALIYLLMV
LKAPESPRWLLLQNNNEAEARRTMESLGSLDVEQTISSIRRDSEQKHEGRLFKPQYKLPI
ALAFLIAAFNQLSGINFIIYYAPRVFDMAGLDASTALLSTAGVGLVNLIFTMIGVSLIDK
YGRRALMYVGSFGYLLSLCTVTWAFSTQAAGAVVVGAIFVFIASHAIGQGAVIWVFIAEI
FPNAVRSKGQSLGSGTHWVFAALIALFMPYVLEAFSATQVFGFFAFAMFLQLLFVRFLMP
ETKGRSLEEVSAALSNKGL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaataagattattagctggtcggtcacggtggctgtagccggtttcctatttggtttt
gacaccgctgtaatctctggggccgaccaagctattgaagcattatggcaaacatcaccg
ttggttcatggactgtttgtaatgtcgtctgcgttatggggaacggtgctaggcgcgctt
tttggtaacaaaccttgcgataaactaggaagaaaaaagacgcttattctgattggtata
ctttatctggtatcagctttagggtcagcgatggcgaacgatccatatattttcgccgca
ttacggtttatcggtggcgttggtgtgggtatatcctcaattgctgtaccggcttatatt
tctgaaatcgcaccaccgcgcatgcgtggaagactggtagcgatgtatcagtttcaaatt
gtattcggcattttaattgcgttcctatcaaactacctcttagccggtgtgattgtccaa
gactggcgtttaatgctggggattgaagctgtgccagctcttatctacctattaatggta
ttaaaagcgccggaaagccccaggtggctgctgctacaaaacaataatgaagccgaagcg
cgccgtaccatggaatctttaggcagtctcgacgtagagcaaactatttcatcaatacgc
agagacagcgaacaaaagcacgaagggcgtttgtttaagcctcaatataagttgccaatc
gcactggcttttctcattgcggccttcaaccaattatccggcatcaacttcattatctat
tacgcacccagagtatttgatatggcgggtctggatgctagtacagccttgctatctacc
gccggtgtaggtttggtgaatcttatcttcaccatgatcggcgttagtcttatcgataag
tatggtcgccgggcattaatgtatgtgggctcgtttggttatttgctttccctttgtaca
gtaacctgggctttttctacgcaggcagcaggcgctgtggtagtcggtgctatattcgtt
ttcatcgcttcccatgcaataggtcagggggcggtaatttgggtatttatagccgaaata
tttcccaacgcggtgcgttccaaaggccagtctctgggaagcggcacacactgggtattt
gccgcattgatcgcgttattcatgccttatgttttagaggccttcagcgcgactcaagta
tttggatttttcgcttttgcaatgtttttgcagttattgtttgtgcgttttttgatgccg
gaaacaaaaggccgttcgctagaagaagtatccgcagcattgtcgaataaaggactctaa

DBGET integrated database retrieval system