KEGG   Salinimonas sp. N102: D0Y50_09230Help
Entry
D0Y50_09230       CDS       T05624                                 

Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
salm  Salinimonas sp. N102
Pathway
salm00010  Glycolysis / Gluconeogenesis
salm00030  Pentose phosphate pathway
salm00051  Fructose and mannose metabolism
salm00052  Galactose metabolism
salm00680  Methane metabolism
salm01100  Metabolic pathways
salm01110  Biosynthesis of secondary metabolites
salm01120  Microbial metabolism in diverse environments
salm01130  Biosynthesis of antibiotics
salm01200  Carbon metabolism
salm01230  Biosynthesis of amino acids
salm03018  RNA degradation
Module
salm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:salm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D0Y50_09230
   00030 Pentose phosphate pathway
    D0Y50_09230
   00051 Fructose and mannose metabolism
    D0Y50_09230
   00052 Galactose metabolism
    D0Y50_09230
  09102 Energy metabolism
   00680 Methane metabolism
    D0Y50_09230
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    D0Y50_09230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:salm01009]
    D0Y50_09230
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:salm03019]
    D0Y50_09230
Enzymes [BR:salm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     D0Y50_09230
Protein phosphatases and associated proteins [BR:salm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     D0Y50_09230
Messenger RNA biogenesis [BR:salm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     D0Y50_09230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AXR06530
UniProt: A0A346NLX3
LinkDB All DBs
Position
complement(2068710..2069711)
Genome map
AA seq 333 aa AA seqDB search
MTKHVAVLTSGGDAPGMNACIRAIVLSCERAGYRVSGFLRGYNGLLEPDRITLTAERMHN
LIQQGGTILHSARCERFCEEDGLKLAARHLNEAEVDTLIVIGGDGSFHGAHALKAHWQGQ
IIGLPGTIDNDVDGTDATIGYYTAIETAVNSIDKVRDTADAFDRVFVVEVMGRHAGFLGL
SAALASASDFVIVPELFSEAQATLAQIRQQIMQRQQRRGPVSYVIVLSEHVWPGGVTRLC
EEVSDITGLEARPVTLGHVQRGGSPVSQDRILAVKLGTHAVSLVGKDVTDIMVGISSGAV
VNVPLQTTWQKQKTLGEDARATALCLMNQRYQD
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacatgttgctgtactcacctccggaggagatgcgccgggcatgaatgcctgc
attcgcgctatcgtcctgagttgcgagcgcgccggttaccgggtatccggttttttacgt
ggctataatggattattggagcccgaccgtattacgctcacagcggaacgtatgcataac
cttattcagcagggcggtaccattttacacagtgcgcgttgtgagcgattttgtgaggag
gacggcttgaagctagccgcccgccatttgaatgaagcagaagtcgataccctgatcgtt
ataggcggcgatggttcattccatggcgcccacgcgctaaaggctcactggcaaggtcag
attatcggcttgcctggcacaattgataatgacgtagatggcacagatgcgactatcggt
tattatacggctatcgaaactgcggtgaactctattgataaggttcgcgatacggcggat
gctttcgaccgggtatttgtagtggaagtaatgggccggcatgccggttttcttggctta
agtgcggccttagcctcggcatctgactttgtcattgtgcctgaactgtttagcgaggcc
caagcaaccctggcacagattcgccagcaaataatgcaacgccagcaacgccgcgggccg
gtgagctatgtgattgtgttatctgagcatgtgtggcctggcggggtcacccgcctatgc
gaagaagtgagtgatattacgggtctggaagcccgccccgtcaccttaggtcacgttcag
cgcggcggatcaccggtcagtcaggaccgtattttagcggtgaaacttggtacacatgcc
gtctcgctggtaggcaaggatgtaaccgatattatggtgggtataagtagtggtgcagta
gtgaatgtgccgctgcaaaccacctggcaaaagcaaaagaccctgggcgaagacgcgcgc
gccaccgccctgtgtttaatgaaccagcggtatcaggactaa

DBGET integrated database retrieval system