KEGG   Salinimonas sediminis: D0Y50_11330Help
Entry
D0Y50_11330       CDS       T05624                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
salm  Salinimonas sediminis
Brite
KEGG Orthology (KO) [BR:salm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D0Y50_11330 (ahpF)
Enzymes [BR:salm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     D0Y50_11330 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like FAD_binding_2 GIDA DAO Lycopene_cycl Thi4 FAD_oxidored NAD_binding_8 AlaDh_PNT_C NAD_binding_7 FAD_binding_3 3HCDH_N K_oxygenase Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: AXR06895
UniProt: A0A346NMY8
LinkDB All DBs
Position
complement(2528837..2530417)
Genome map
AA seq 526 aa AA seqDB search
MLTKEILQALKGYAESMQKEVTFVLQTGEHSKRDELVTFLSDIAGVSDNIKFEERDTAGV
LRSSLSFLLEADSEDTGIRFSGIPGGHEFNSLVLALLHASGTALKVDDSLKSIIKGVKED
LNFEVFISLSCHNCPEVVQALNQFALINPHIKTEMIDGGLYPNLIAEREIQGVPSVYLNG
ELFANGKVEAGTIIEKLIERDPALKDANKGQSMPLQDVTVIGGGPAGVSSAIYSARKGLK
VTLVADRFGGQVKDTMGIENLISVSKTTGPELVNNLLEHMNDYDITLKEHVRVDNIEKGN
IKTITLSSGEQITSRSVIVATGARWRELGVPGERENVGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVTVFEFMPELKADQVLVKQAEKRDNVTIIRNAATRQIVAEN
GKVSAIEYQDRATNEVHTLPLAGVFVQIGLVPNSQFLDGVIELTKHGEVNIDEKCNTSEP
GIYAAGDVTTVPYKQIVVSMGEGAKASLAAFEYLLTHETEQEAATA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgttaactaaagaaattttgcaagcgcttaaaggctatgctgaatccatgcaaaaagaa
gtaacgttcgtgctacaaactggcgaacacagcaagcgtgacgagctcgtgacgtttctg
tctgacattgctggtgtgagcgataacattaagtttgaagaacgtgacactgcaggtgtt
ttgcgtagctcactaagctttttattagaagccgatagtgaagataccggtatacgtttt
tctggtatccctggtggtcacgagtttaactcattagtccttgctttgttgcatgcctca
ggcacagcattgaaggttgatgatagtctgaaatctatcatcaaaggtgtcaaagaagac
cttaactttgaagtatttatcagcctaagctgtcataactgtccggaagttgtccaggca
ttgaaccagtttgcgctaatcaacccgcacattaaaactgaaatgattgatggtggtttg
tatccgaacctgattgctgagcgggaaatacagggcgtgccttcggtttacctgaatggc
gaattattcgcaaatggtaaagtagaagccggtactatcatcgaaaaattgattgaacgc
gaccccgcgttaaaagatgctaacaaaggtcagtcgatgcccttgcaagatgtcaccgtt
attggtggtggcccggctggcgttagctctgcaatttacagtgcgcgtaaaggcttgaaa
gtaaccctggtagccgaccgctttggtggccaggttaaagataccatggggattgaaaac
ctgatttcggtatccaaaaccactggtcctgagctggttaataacctgctcgagcatatg
aacgattacgatattacgcttaaagaacatgttcgggtggataatatcgaaaagggtaat
attaaaacgattaccttgtcatcaggcgagcaaattacctcacgatcagtgattgtagct
acgggtgcacgttggagagaactaggcgtacctggcgagcgtgaaaatgtgggtaatggt
gtggcatattgtccgcattgtgatggtccgttctttaaaggtaaagacgtcgcggtaatc
ggcggcggtaattcaggtattgaagccgcgctggacttggccggtattgttaagtcggta
acagtatttgagtttatgcctgaactaaaggccgatcaagtattggttaaacaggctgaa
aaacgtgacaacgttactattattcgcaatgccgcgacccgtcagattgtagcggaaaac
ggcaaggttagtgcaattgagtatcaggatcgggccactaacgaagttcacactctgcct
ttggcaggggtctttgtacaaattggtctggtgcccaacagccagttcctggatggggtg
attgagctaactaagcacggtgaagtcaatatcgatgagaagtgtaatacttctgagcct
ggtatttatgctgcgggtgatgtgactaccgtaccttacaagcaaattgtggtatccatg
ggcgagggtgcgaaagcctctttagcagcattcgaatatttgctaacccatgaaactgag
caagaggcggcaaccgcctag

DBGET integrated database retrieval system