KEGG   Salinisphaera sp. LB1: SALB1_0496Help
Entry
SALB1_0496        CDS       T05476                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
saln  Salinisphaera sp. LB1
Pathway
saln00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:saln00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SALB1_0496
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:saln02000]
    SALB1_0496
Enzymes [BR:saln01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SALB1_0496
Transporters [BR:saln02000]
 Other Transporters
  Pores ion channels [TC:1]
   SALB1_0496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AWN14703
LinkDB All DBs
Position
complement(545103..545774)
Genome map
AA seq 223 aa AA seqDB search
MITVHHLENSRSQRVLWLLEELAIAYKVERYARDPKTQLAPDALKRVHPLGKAPVITDGR
RTVAETGLIIDYIVREHGDGQLAPAPDSEDHLRYQYWLHYAEGSLMPPLLLQLVFDTVEK
KTPLPARPIARAICGQVKKQFIRPQRLLHFDYLENELRSHEWFVGERFSAADIMLSFPIE
AAMARGGTGERCPKLREFVERIHARPAYQRALERGGPYAFAHS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatcacggttcaccatctcgaaaattcgcgttcgcagcgtgtgctctggctgctcgaa
gagctggcgatcgcgtacaaggtcgaacgttacgcgcgtgacccgaaaacgcagctcgcc
cccgatgcgctcaagcgtgttcatccgctcggcaaggcgccggtgattacggacgggcgc
cgcaccgtggccgagaccggcctgatcatcgactacatcgtacgcgagcacggcgacggt
cagctcgcgccggcgccggacagcgaggaccacctgcgctatcaatactggttgcattac
gccgagggatcgctgatgccgccgctgctattgcagttggtctttgacaccgtcgagaag
aagacgcccctgccggcgcggccgatcgctcgcgcgatctgcggacaggtcaaaaagcag
ttcatccggccgcagcggctgctgcatttcgattatctggaaaacgaattgcgcagtcac
gagtggttcgtgggcgagcgcttcagcgccgccgatatcatgctgagctttcccatcgag
gctgccatggcgcggggcggcactggcgaacggtgcccgaagctgcgcgaatttgtcgag
cgtatccatgcccggccggcctaccagcgggcgctcgagcggggcgggccgtacgctttt
gcgcattcctga

DBGET integrated database retrieval system