KEGG   Salinisphaera sp. LB1: SALB1_1922Help
Entry
SALB1_1922        CDS       T05476                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
saln  Salinisphaera sp. LB1
Pathway
saln00473  D-Alanine metabolism
saln00550  Peptidoglycan biosynthesis
saln01100  Metabolic pathways
saln01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:saln00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SALB1_1922
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SALB1_1922
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SALB1_1922
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:saln01011]
    SALB1_1922
Enzymes [BR:saln01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SALB1_1922
Peptidoglycan biosynthesis and degradation proteins [BR:saln01011]
 Precursor biosynthesis
  Amino acid ligase
   SALB1_1922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AWN16120
UniProt: A0A2Z3J9B8
LinkDB All DBs
Position
complement(2073115..2074206)
Genome map
AA seq 363 aa AA seqDB search
MGRTRVAVICGGASAEHEVSLQSARNIVAALDRERFEVFVIGIDKAGVWHAADPADFVYH
PDDPKRIALKADAAALAIVPGRESGQIVNADSGEIALEIDVAFPIVHGPTGEDGTLQGLL
RAANIACVGAGVLGSAAAMDKDIAKRLLRDAGLAIAPFEVVTAADRPLDHAALTARLGSP
LFVKPANLGSSVGVSRATNAGELAAAIDLALRFDHKVLIESAVTGREIECAVLGNSEPQA
STVGEVVVADGGFYAYDTKYVNDTAQVVIPAELDADSIEAVRRVALAAYRALDCRGLARV
DVFVTPEGHVVVNEINTLPGFTRISMYPKLWAESGIAYPALVARLVDLAREQHAADRALA
TSM
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggccgaacgcgagtagccgtgatctgcgggggcgcctcggccgagcacgaggtgtcg
ctgcaatcggcgcgcaatatcgtcgcggcgctcgatcgcgagcgcttcgaggtgttcgtc
atcggcatcgacaaggccggcgtctggcatgccgccgatccggccgatttcgtgtaccac
ccggacgatccgaagcgtatcgcgctcaaggccgacgccgcggcactcgccatcgtgccc
ggccgcgaatccggccagatcgtgaacgccgacagcggcgagatcgcgctggaaatcgac
gtggcctttcccatcgtgcacgggccgaccggcgaggacggtaccctgcagggcctgctg
cgggccgccaacatcgcctgtgtcggcgccggcgtgctcggctcggccgcggccatggac
aaggacatcgccaagcggctgctgcgcgacgccgggctggcgatcgcgccgttcgaggtg
gtgaccgccgcggaccggccgctggatcatgccgcgctgaccgcgcgtctgggcagcccg
ctgttcgtgaaaccggccaatctgggctcatcggtcggcgtgagccgggccaccaatgcc
ggggagttggccgcggcgatcgatctcgcgctgcgcttcgatcacaaggtgctgatcgag
tcggcggtgaccgggcgcgagatcgagtgcgccgtactcggcaatagcgagccccaggcg
agcacggtcggcgaggtggtagtcgccgacggcggtttctatgcctacgacaccaagtac
gtgaacgacaccgcgcaggtcgtgatcccggccgaactcgatgccgacagcatcgaggcc
gtgcgccgcgtggccctggccgcctaccgcgcgctggactgccgcgggctggcgcgggtg
gatgtgttcgtcactcccgagggccatgtggtggtcaatgaaatcaacacgctgcccggc
ttcacccgaatttccatgtatccgaaactctgggccgaatccggcatcgcctatcccgcg
ctggtcgcgcggctggtagatctggcgcgggaacaacacgcggcagaccgggctctggcg
acctcgatgtag

DBGET integrated database retrieval system