KEGG   Salinisphaera sp. LB1: SALB1_2613Help
Entry
SALB1_2613        CDS       T05476                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
saln  Salinisphaera sp. LB1
Pathway
saln00250  Alanine, aspartate and glutamate metabolism
saln00410  beta-Alanine metabolism
saln00640  Propanoate metabolism
saln00650  Butanoate metabolism
saln01100  Metabolic pathways
saln01120  Microbial metabolism in diverse environments
Module
saln_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:saln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SALB1_2613
   00650 Butanoate metabolism
    SALB1_2613
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SALB1_2613
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SALB1_2613
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:saln01007]
    SALB1_2613
Enzymes [BR:saln01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SALB1_2613
Amino acid related enzymes [BR:saln01007]
 Aminotransferase (transaminase)
  Class III
   SALB1_2613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AWN16809
UniProt: A0A2Z3JB67
LinkDB All DBs
Position
2849614..2850876
Genome map
AA seq 420 aa AA seqDB search
MTANRPGHLSPLLKQATDVYAERGEGCYLFDTEGRRYIDFTSGIGVTSTGHCHPKVVAAA
QAQVGKLIHGQYTTIMHKPIQDLSARLAEKMPGDIDTMFYASAGTEAAEGAMRLMRHATG
RPNIVVFHGGFHGRTMGAASMTTSGTAYTAGLQPIMGGVVVAPFPNAFRYGWSEDEATDF
CLRELDHIFDTISSPKDTAGFLIEPIQGEGGFVPANTRFMQGLRERADRHGLVLGVDEVQ
AGYGRTGKFWSHSHFDVQPDIVMTAKGLASGFPLSGFGASRALMEKGWPGSQGGTYGGNA
VACAAALATLDVIEEEGLVENAAEQGAHLKQRLESLAADHECIADVRGKGFMIGCEIQKD
GEPDGSGADHIVKACEASGLLLLRCGPRKQVIRWLPPLVANRDQIDEALDIFAKALNATA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaatcgcccgggtcacctgtccccactgctcaagcaggccaccgacgtctac
gccgagcgaggcgagggctgctatctgttcgacaccgaaggtcgccgttacatcgatttc
acctccgggatcggcgtgaccagcaccggccattgtcatcccaaggtcgtggccgccgcc
caggcgcaggtcggcaaactgatccacggtcagtacaccacgatcatgcacaagccgatt
caggatctctcggcgcgtctggccgagaagatgccgggcgacatcgataccatgttctac
gccagcgccggcaccgaggccgccgaaggcgcgatgcgcctgatgcgccacgccaccggc
cgcccgaacatcgtggtattccatggcggcttccacggtcgcaccatgggcgcggcctcg
atgaccacctccggcaccgcgtataccgccggcctgcagccgatcatgggcggcgtggtg
gtggcaccgttccccaatgccttccgctacggttggtcggaagacgaggcgaccgatttc
tgcctgcgtgaactggatcatatcttcgacacgatcagctcgccgaaggacacggccggc
ttcctgatcgagccgatccagggcgagggcggtttcgtgccggccaacacccgcttcatg
caggggctgcgcgagcgtgcggatcggcacggcctggtgctcggcgtggacgaagtccag
gcgggctatggtcgcaccggcaagttctggtcgcatagccacttcgatgtgcagccggat
atcgtgatgaccgccaagggactggcctcgggcttcccgctgtccggtttcggcgcctcg
cgtgcgctgatggaaaaaggctggccgggctctcagggcgggacgtatggcggcaacgcc
gtggcctgcgcggcggcgctggcgaccctggatgtaatcgaagaggaaggcctggtggag
aacgcggccgagcagggcgcgcatctcaagcagcgcctggaatcgctggcggccgatcac
gagtgcatcgccgatgtgcgcggcaagggcttcatgatcggttgcgagatccaaaaggac
ggcgagcccgacggcagcggcgccgatcatatcgtcaaggcctgcgaggcctcgggactg
ctgctgctgcgctgtggtccgcgcaagcaggtgatccgctggctgccgccgctggtcgcc
aaccgcgatcagatcgatgaggcgctggatatcttcgccaaggcgctgaacgccaccgct
tga

DBGET integrated database retrieval system