KEGG   Salinisphaera sp. LB1: SALB1_2638Help
Entry
SALB1_2638        CDS       T05476                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
saln  Salinisphaera sp. LB1
Brite
KEGG Orthology (KO) [BR:saln00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SALB1_2638
Enzymes [BR:saln01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SALB1_2638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like DAO FAD_binding_3 K_oxygenase Thi4 NAD_binding_8 Glutaredoxin AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: AWN16834
UniProt: A0A2Z3J6B8
LinkDB All DBs
Position
complement(2879827..2881422)
Genome map
AA seq 531 aa AA seqDB search
MLDDNIKQQLTAHFDKIAHDIEIVASVDDGKGSADMLSMLEELAALSPKIALHESRDDNE
RKPSFNVRRAGSDMHIRFAGIPTGHEFTSLVLALLQAGGHPVKASDSVIAQIENLDGEFH
FETYISLSCQICPDVVQAINVMAVLNPNVHATMIDGAHFQDEVESREVMAVPTIFLNGEP
FHSGRISLEEIVNRIDDSAAERDAAEIDAKDAFDVLVVGGGPAGASAAVYAARKGIRTGV
VADRFGGQVLDTAGIENFISVPETEGPKLATQLEQHVLSYDVDIMKPQTAAELVPGELFE
VKLDSGATLRSRSVILSTGARWRQMQVPGEAEYRNRGVAYCPHCDGPLYKGKHVAVIGGG
NSGVEAAIDLSGLVKHVTLIEFEDELRADAVLQRKLHSLSNVSILTHAQTTEVVGDGKKV
TGLKYLDRGTDERHEIALEGVFVQIGLIPNTDWLEGVVDMTDRGEIITDEHGQTSVPGVF
AAGDVTTVPYKQIVIAMGEGATASLGAFDYLIRHSAPAEQAETDQRQSRVA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgacaacatcaagcaacagttgaccgcgcacttcgacaagatcgcgcacgac
atcgaaatcgtggcatcggtcgatgacggtaagggctcggccgacatgttgtcgatgctt
gaggagctcgcggctctgtcgccgaagatcgccctgcacgaatcgcgcgatgacaacgag
cgcaaaccctcgttcaacgtccgtcgcgccggcagcgacatgcacatccgctttgccggc
attcccaccggccacgaatttacctcgctggtgctggccctgctccaggccggcggtcat
ccggtcaaggcgagcgattcggtgatcgcccagatcgagaatctcgacggcgagttccac
ttcgagacatatatctcgctgtcgtgccagatctgcccggatgtggtgcaggccatcaac
gtgatggcggtcctgaatcccaatgtgcacgccaccatgatcgatggcgcccatttccag
gatgaggtcgagtcccgcgaggtgatggcggtgcccacgatcttcctgaacggcgagccg
ttccactccggccgtatcagtctggaagagatcgtcaaccgcatcgatgacagcgctgcc
gagcgagatgccgccgaaatcgatgccaaggacgccttcgatgtgctcgtggtcggcggt
gggccggccggcgcctcggccgcggtctatgccgcacgcaagggcattcggaccggcgtg
gtggccgaccgtttcggcggtcaggtgctcgataccgcggggatcgagaatttcatctcc
gtgcccgaaaccgaagggccgaaactcgcgacccagctggaacagcatgtgctgtcctac
gacgtggacatcatgaagccgcagaccgcggccgaactcgtgccgggcgaactgtttgaa
gtgaagctcgattccggcgccaccctgcgctcgcgttcggtgattctttcaaccggcgcg
cgctggcggcagatgcaggtgccgggcgaagccgaataccgcaaccgcggcgtggcctac
tgcccgcattgcgacggcccgctgtacaagggcaagcatgtggcggtgatcggcgggggc
aactccggcgtcgaggcggcgattgatctgtccggtctcgtcaagcacgtcacactcatc
gagttcgaagacgaactgcgggcagatgcggtgctgcagcgcaagctgcacagcctgtcc
aacgtctcgatcctcacccacgctcagaccaccgaagtggtcggcgacggcaagaaggtc
accggtctgaagtatctggaccgcggcaccgacgagcggcacgagatcgcgctggaaggc
gtgttcgtccagatcggcctgatcccgaacaccgattggctcgagggcgtggtcgatatg
accgatcgcggcgagatcatcaccgacgaacacggccagacctcggtgcccggcgtgttt
gctgcgggcgatgtgacgaccgtgccctacaagcagatcgtcatcgccatgggcgaaggc
gccacggcttcactgggcgccttcgactatctcatccgccattcggcgccggccgaacaa
gccgaaaccgaccaacgccaatcccgggtggcctga

DBGET integrated database retrieval system