KEGG   Salinisphaera sp. LB1: SALB1_2955Help
Entry
SALB1_2955        CDS       T05476                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
saln  Salinisphaera sp. LB1
Pathway
saln00250  Alanine, aspartate and glutamate metabolism
saln00410  beta-Alanine metabolism
saln00430  Taurine and hypotaurine metabolism
saln00650  Butanoate metabolism
saln01100  Metabolic pathways
saln01110  Biosynthesis of secondary metabolites
saln01120  Microbial metabolism in diverse environments
saln02024  Quorum sensing
Module
saln_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:saln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SALB1_2955
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SALB1_2955
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SALB1_2955
   00430 Taurine and hypotaurine metabolism
    SALB1_2955
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SALB1_2955
Enzymes [BR:saln01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SALB1_2955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AWN17149
UniProt: A0A2Z3JC90
LinkDB All DBs
Position
complement(3226275..3227660)
Genome map
AA seq 461 aa AA seqDB search
MTENMVKKLKPDAELAPTYGSRVMSRPVPKYALPQSEMPPRTAYQLIHDELMLDGNARLN
LASFVTTWMEPEAERLMAETFDKNMIDRDEYPQTAEIETRCVNMIARLFNAPKDADPVGV
SAIGSSEAVMLAGMALKWRWRARREAAGQPADRPNLILGSNVQVVWEKFCRYWEVEPRYI
PMREGRYVITPEEVTSRVDENTIGVVAILGTTFTGEFDPIQAIHDTVLAYNAAHGLAVPL
HIDAASGGFVAPFIHPELRWDFRLPNVVSINTSGHKYGLVYPGVGWVLWRDKEHLPDDLV
FHVNYLGGDMPTFTLNFSRPGNQVIGQYYNFLRLGHAGYTRIMHTLQETATGLAGRIEKL
GHFELLSRGDTIPVFAFRLKETSRYSVYDVSERLRVRGWQVPAYTMPPEAESVAVLRIVV
REGFSRDMADLLLDDLCKAVHELETSPPESPRRSGGQFHHG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgacggaaaacatggtcaaaaagttgaaacccgacgccgagcttgcgcccacctacggc
tcgcgagtcatgtcgcgcccggtgcctaaatacgccctcccccagtccgagatgcccccg
cgcacggcctaccagctcatccacgatgagctcatgctcgacggcaacgcccggctgaac
ctggcctccttcgtaaccacttggatggagcccgaggccgagcggctgatggccgagacc
ttcgacaagaacatgatcgaccgggacgagtatccgcagaccgccgagatcgagacacgc
tgcgtaaacatgatcgcgcggctgttcaatgcacccaaggatgccgaccccgtaggtgtc
tccgccatcggctccagcgaggcggtgatgctggccggcatggcgctgaagtggcgctgg
cgagcccggcgggaggccgcgggccagccagccgaccggcccaacctgattctgggcagc
aatgtgcaggtcgtgtgggagaagttctgccgctactgggaggtggagccgcgctatatc
cccatgcgcgagggccgctacgtgatcaccccggaggaagtgaccagccgcgtcgatgaa
aacactatcggggtggtagccatactgggcaccaccttcaccggcgagttcgatcccatc
caggccatccacgataccgtcctggcctataacgcggctcacggcctggccgtgccgctg
catatcgacgcggccagcggcggcttcgtcgccccgttcatccaccccgaactgcgctgg
gacttccgtctgcccaacgtggtctcaatcaacacctcgggccacaagtacgggctggtc
tacccgggtgtcggctgggtactgtggcgtgacaaggagcatctgccggacgacttggtc
ttccacgtgaattacctgggcggggacatgcccaccttcacgctgaacttctcgcgccca
ggcaatcaggttatcggacagtattacaatttcctgcgcctgggccacgcgggctacacc
cgcatcatgcatacgctgcaggaaacggccaccggactggccggacgcatcgaaaaactc
ggtcatttcgagctgctgagccggggcgacaccattcccgtattcgcgttcaggctcaag
gaaacttcgaggtattcggtatacgacgtttctgagcggctgcgcgtgcgcggctggcag
gtaccggcctacaccatgccgcccgaggccgaatccgtcgctgtactccgcatcgtggta
cgcgagggattctcacgcgacatggccgatctgttgctcgacgatctctgtaaagccgtc
cacgaactcgagacctcgcctccggaatctccccggcgctctggcgggcaattccatcac
ggctga

DBGET integrated database retrieval system