KEGG   Salinisphaera sp. LB1: SALB1_3018Help
Entry
SALB1_3018        CDS       T05476                                 

Definition
(GenBank) Integral membrane protein
  KO
K07090  uncharacterized protein
Organism
saln  Salinisphaera sp. LB1
Brite
KEGG Orthology (KO) [BR:saln00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SALB1_3018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE TPPK_C DUF3675
Motif
Other DBs
NCBI-ProteinID: AWN17212
UniProt: A0A2Z3J7G2
LinkDB All DBs
Position
3307675..3308427
Genome map
AA seq 250 aa AA seqDB search
MEQTVLLLIAALVVGMSKGGLASAAAISVPMLSLFMNPIHAAALLLPVYIVTDWVAVWLY
RHEYSGRNLVILIPAMLLGVAVATVVTPYTPESLLLIVTGLIGLWYCLRTWLRRGVAERT
EARVLPGVLWGTITGITSFITHSGGPPAQAYLLPQRLPKLQFAGTIAIAFAACNLAKLPA
YWEIGNLQDLNWQTTLALAATGIVGTRIGRAISLVLSESSYRRVIETMLFLLSIILLGKG
GWMLLHPTLA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggaacagacggttctgttgctgatcgcggctctggtcgtgggcatgtccaagggcggg
ctggcctcggcggcggcgatttcggtgccgatgctgtcgctgttcatgaatccgatccat
gccgcggcgctattgctccccgtgtacatcgtgaccgactgggtcgcggtgtggctctac
cggcatgagtattcgggccggaatctcgtgatcctgattccggccatgctgctcggcgtt
gccgtggccaccgtggtcacgccgtatacgccggaaagtctgttgttgatcgtcaccggc
ctgatcggtctgtggtattgcttgcgcacctggctccggcgcggcgtggccgagcggact
gaagcccgcgtgttgcccggtgtgttatggggcacgatcaccgggatcaccagcttcatt
acccattccggtggtccgcctgcccaggcttatctcctgccgcaacggctgccgaaactg
caattcgccggcaccatcgcgatcgcgttcgcggcctgcaacctggccaagctgccggcc
tactgggagatcggtaatctccaggatctgaactggcagaccacgctggcgctggccgcg
accggcatcgttggcacccgtatcgggcgtgcgatctcgctcgtgctctccgagagcagt
tatcggcgggtgatcgaaaccatgctgtttctgctatcgatcatcctgctcggcaagggc
ggctggatgctgctgcacccaacgctcgcctga

DBGET integrated database retrieval system