KEGG   Salinisphaera sp. LB1: SALB1_3043Help
Entry
SALB1_3043        CDS       T05476                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
saln  Salinisphaera sp. LB1
Pathway
saln00550  Peptidoglycan biosynthesis
saln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saln00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SALB1_3043
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:saln01002]
    SALB1_3043
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:saln01011]
    SALB1_3043
Enzymes [BR:saln01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SALB1_3043
Peptidases [BR:saln01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   SALB1_3043
Peptidoglycan biosynthesis and degradation proteins [BR:saln01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SALB1_3043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AWN17237
UniProt: A0A2Z3JFZ1
LinkDB All DBs
Position
complement(3334964..3336115)
Genome map
AA seq 383 aa AA seqDB search
MRKSVLCSCLFLVFVATGAAQAADTPSAPPLIVPHMAPLGAKSYVLMDYRTGRILAAKNK
DKELAPASTTKLMTAFVVFRALKRGRITLDTKFRVSKKAWHEGGSRMFLKVGSHVSVDNL
LKGMLVPSGNDAAMTLAEGVSGSEQAFVARMNRDARQLGLHDTHYTDPNGLPRPGLHSSA
LDLAKLSRAIIRRFPKEYARFFAVKSFTWNNIHQNNYNKLLWRDPSVDGLKPGYVSAVGY
NLAASAKRHGMRLIGVVMGADKPKASSAANYINLAQVTGSLLDYGFHNYATHKMYAAGQS
VFKAPVKHGDQDKVALGLRKTLYVTVPRGQYAQLKASVKLPGSITAPVKQGQSIGHLVVK
LGPRVVARAPLVALAGDKRYSFW
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcggaagtcagttctctgttcgtgcctgttccttgtctttgtcgccaccggggcagcg
caggcggccgacacgccgtccgcgccgccgctgatcgtgccgcatatggcgccgctgggc
gccaagtcttatgtgctgatggactatcgaacgggccggatactggcggcgaagaataag
gataaggagctggcacccgcgagcacgacgaagctgatgaccgcgttcgtggtgttccgg
gcactcaagcgtgggcggatcacgctcgacacgaagttccgcgtgagcaagaaggcctgg
catgaaggcggctcgcggatgttcctcaaggtcggctcgcacgtgagcgtcgacaatctg
ctgaaaggcatgctggtgccctcgggcaacgatgcggcaatgacgctggcggaaggtgtc
agcggtagcgagcaggcattcgtggcgcggatgaatcgcgacgcccgccagctcggcctg
cacgacacgcattacaccgatcccaacggcctgccccgccccggcctgcatagctcggcg
ctcgatctggccaagttgtcgcgggcgatcattcgccggttccccaaagagtacgcgcgc
ttttttgccgtgaaatcattcacctggaacaacattcatcagaataactacaacaagctg
ttgtggcgcgatccgagtgtcgatgggttgaagccgggctatgtgagcgcggtgggctat
aacctcgcggcttcggcgaagcgccatggcatgcggctgatcggtgtggtgatgggcgca
gacaagcccaaggcatcgagtgcggcgaactacatcaacctggcacaggtgaccggctcg
ctgctggactatggcttccacaattacgccacgcacaagatgtacgcggcgggacagtcc
gtattcaaggcgcccgtcaaacacggcgatcaggacaaggtcgcgctggggctgcgaaag
acgctttacgtgacggtaccgcgcgggcaatacgcccagttgaaggcgagcgtgaagttg
cccggttcgatcacggcgcccgtcaagcaagggcaatcgatcgggcacctggtcgtgaaa
ctggggccgcgcgttgtagcccgggccccgctcgtcgcgttggcgggggataagcgctat
agcttttggtag

DBGET integrated database retrieval system