KEGG   Silicimonas algicola: EF888_13930Help
Entry
EF888_13930       CDS       T05779                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
salo  Silicimonas algicola
Pathway
salo00040  Pentose and glucuronate interconversions
salo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EF888_13930
Enzymes [BR:salo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     EF888_13930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 HI0933_like UDPG_MGDP_dh_N 3HCDH_N DUF4047
Motif
Other DBs
NCBI-ProteinID: AZQ68136
UniProt: A0A316G9V6
LinkDB All DBs
Position
complement(2826713..2827765)
Genome map
AA seq 350 aa AA seqDB search
MKSLVLERKDDLSLRDVPEIDRAEQDLGPHDVRIKLHTVGICGSDVHYYTHGKIGPFEVK
APMILGHEASGTVIETGADVTTLKPGDRVCMEPGIPDPNSKATRMGMYNIDPAVRFWATP
PVHGILRPTCVHPEAFTFKLPDTVSFAEAAMVEPLAVGVHAATKARVRPGDIAVVLGAGP
IGLVTALSALAAGCARVYVTDIAEKKLEIAGSLSRAITPVNVTSENLVEVVKRDTDGWGA
DLVFEATGSPRAAAQIFEPLAPGGCVVMIGGQPDPISYDAGAAMVREARVENIFRYAHVF
PRCVAMLASGAIDVKPLITRTFEFDDSVHAFEVAASAPPADVKMQIVLPQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgcttgttctcgaacgcaaggacgacctgtcgctgcgcgacgtccccgagatc
gaccgcgccgagcaggacctcggtccgcatgacgtgcggatcaagctgcacaccgtcggg
atctgcggctcggacgtccactactatactcacggcaagatcgggcccttcgaagtgaag
gcaccgatgatcctggggcacgaggcgtcggggaccgtgatcgagaccggcgcggacgtg
acgacgctgaagccgggcgaccgcgtctgcatggagccgggcatccccgacccgaactcg
aaagccacgcggatggggatgtacaacatcgaccccgccgtgcgcttctgggcgacgccg
cccgtccacggcatcctgcgtcctacctgcgtccaccccgaagccttcaccttcaagctg
cccgacaccgtcagcttcgccgaagcagcgatggtcgaacccctggcggtcggcgtccat
gccgcgaccaaggcgcgggtcaggccgggcgatatcgccgtggttctgggggcggggccg
atcggccttgtcaccgctctgtcggcgctcgcggcgggatgcgcgcgggtctatgtcacc
gacattgccgagaagaagctcgagatcgcgggaagcctgagccgcgccatcacgcccgtg
aacgtcacgagcgaaaacctcgtcgaggtcgtgaagcgcgacaccgacggctggggtgcg
gacctggtgttcgaggcgaccgggtcgccgcgcgcggccgcccagatcttcgagcccctg
gcgcccggcggctgcgtcgtgatgatcggcggccagcccgatccgatcagctatgacgcg
ggtgccgccatggtgcgcgaggcgcgggtcgagaacatcttccgctacgcccacgtcttt
cctcgctgcgttgcgatgctggcgtccggcgccatcgacgtgaagccgctcatcacccgg
acattcgaattcgacgacagcgtgcacgccttcgaagtcgccgcctcggccccgcccgcc
gacgtgaagatgcagatcgtgctgcctcaataa

DBGET integrated database retrieval system