KEGG   Silicimonas algicola: EF888_17260Help
Entry
EF888_17260       CDS       T05779                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
salo  Silicimonas algicola
Pathway
salo00240  Pyrimidine metabolism
salo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    EF888_17260
Enzymes [BR:salo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     EF888_17260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30
Motif
Other DBs
NCBI-ProteinID: AZQ68720
UniProt: A0A316G8A2
LinkDB All DBs
Position
3512495..3513094
Genome map
AA seq 199 aa AA seqDB search
MAKLYFHYSTMNAGKSTLLLQASYNYRERGMQTYLLTASIDGRAGQGRIASRIGITASAD
VFDRDSDLFVLLERRQRQGPVACVFVDESQFLTVPQVWQLARAVDDLELPVMCYGLRTDF
RGELFPGSAALLALADEMREARTICFCGRKATMVVRQDEDGRALTEGDQVQIGGNETYVS
LCRLHWREATGDRPAASSP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctacttccattactcgaccatgaacgcgggcaagtcgacgcttctgctt
caggcgtcctacaactaccgcgaacgcggaatgcagacctatctcctgaccgcctccatc
gacggccgcgccgggcaaggacgcatcgccagccggatcggcatcacggcgtcggccgac
gtcttcgaccgcgacagcgacctcttcgtcctcctcgaacggcggcagagacagggtccc
gtcgcctgcgtcttcgtggacgagtcgcagttcctgaccgtcccgcaggtctggcaactc
gcccgcgccgtcgacgacctcgaattgcccgtgatgtgctacggcctgcgcaccgacttc
cggggcgagctctttcccggctccgcggctctgctggcgctggccgacgaaatgcgcgag
gcgcgcaccatctgcttctgcggccggaaggcgactatggtcgtccgccaggacgaggac
ggccgcgccctcaccgagggcgatcaggtccagatcggtggcaacgagacctacgtctcg
ctgtgccggcttcactggcgcgaggcgacgggagaccgtccggcggcgtcatcaccgtga

DBGET integrated database retrieval system