KEGG   Salvelinus alpinus (Arctic char): 111949918
Entry
111949918         CDS       T05762                                 

Definition
(RefSeq) nitric oxide synthase, inducible-like isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00220  Arginine biosynthesis
salp00330  Arginine and proline metabolism
salp01100  Metabolic pathways
salp04020  Calcium signaling pathway
salp04146  Peroxisome
salp04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    111949918
   00330 Arginine and proline metabolism
    111949918
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111949918
   04020 Calcium signaling pathway
    111949918
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111949918
Enzymes [BR:salp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     111949918
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1
Other DBs
NCBI-GeneID: 111949918
NCBI-ProteinID: XP_023823033
LinkDB
AA seq 780 aa
MFKSLCEHLQFATNGGSIRSAITVFPLRKGDMQDFRVWNSQLVKYAGYQMPDGSIQGDPS
SVEFTEICIQLGWKPQYGLFDVLPLVLQVNGEDPDLYEIPPHLILEVPMEHPQYKWFQDL
GLKWYAVPAVSNMLLEIGGLEFTACPFNGWYMGTEIGVRDFCDYQRYNVLEEVGRRMGLE
THKLSSLWKDQALVTINVAVIYSFQKNKVTITDHHSAAESFMKHMETEFRLRGGCPADWA
WLVPPMSGSLTPVFHQEMVNYILSPFFYYQPDPWTTHVWRNGEKCLRKQQISFKAVARAA
LFSSTLMSRVLANRVRCTVLYATETGKSQTLAQRLNSMLNCAFNCRLLCMEDYNFSDMEQ
ESLLVVVTSTFGNGDSPGNGESFKKQLFSLQYLRNKLRYCVFGLGSRMYPQFCAFAHAVD
AKLEELGAERVTPTGEGDELNGQEEAFSAWALTALKDAYKEFNIQGQLSLQLPGAERLCE
AWDPLRYRVALESCSQDHITALSAIHSKTVFPMKLKRRQNLQSPHSSRSTILVELERETS
AEVMNFAPGDHVGVFPGNLPQLVAGILKFLPHTPATNQCLRLEYRSDSCLDDEKNWQTVR
RIPACPLSQALTYFLDVTTPPCQNLLHKLSQLARQEGHCQRLLTLAKDSQEYTTWKMFRV
PNFLEVLEEFPSLEPSAAFLLSELPLLKPRLYSISSSPQLHPNELHLTLTVLNYHTQDGQ
GPLHHGVCSTWLDTIKKGDLVLCFIYRWVPPPSRAQHSSHSGGGWQWHCALPKLLATTAT
NT seq 2343 nt   +upstreamnt  +downstreamnt
atgttcaagtctctgtgcgaacacttacagtttgccacaaatggaggaagcataaggtct
gcgattaccgtcttccctctgagaaagggagacatgcaagatttccgggtgtggaacagc
cagttggtgaagtatgcaggttaccagatgcctgatggcagtatccagggagacccatcc
agtgtagaattcactgagatctgtatccagcttggatggaaacctcagtacggcctcttc
gatgtattgccactagtcctgcaggtcaacggggaggacccagacctttatgaaatccct
ccacacctgatcctggaggttcccatggaacaccctcagtataagtggttccaagacctt
ggactgaagtggtatgctgtgcctgcggtgtccaacatgctgctggagattggtggactt
gaattcacagcctgtccctttaatggctggtacatgggcactgaaattggtgtgagggat
ttctgtgactatcagcgttataacgtcttggaggaagttggtcgcaggatgggcctggag
acacacaagctgtcctcactgtggaaggaccaggccttggtgaccatcaatgttgcagtc
atatacagtttccagaagaacaaggtgaccatcacagaccaccactctgcagccgagtcc
tttatgaagcacatggagacagagttccggctgcgtggcggctgccctgcagactgggcc
tggctggttcctcccatgtctggctccctcacccccgtcttccaccaggagatggtcaac
tacatcctctctcccttcttctactaccagcctgacccctggacgacccatgtctggaga
aatggggagaagtgcctgaggaagcaacagatcagcttcaaagcggtggccagggcggcg
ctcttttcttcaacccttatgagcagagtgctggctaacagggtgcgttgcactgtcctg
tacgctactgaaacagggaaatcacagacattggcccagagactgaactccatgctaaac
tgtgccttcaactgcaggttgctctgtatggaggactataacttcagtgacatggaacag
gagagccttctggttgtggtaacaagcacctttgggaatggagactcccctggaaatgga
gagagtttcaagaagcagcttttctccttgcagtatctcaggaacaagttaaggtactgt
gtgtttggactgggctcgaggatgtacccacagttctgtgcgttcgcccatgccgtggat
gccaagctggaggagctgggggcagagcgggtgacgcccactggagagggggatgaactg
aacggacaggaggaggccttctctgcctgggctctcaccgctctcaaggatgcctataag
gagttcaacatccagggacagctgagtctgcagctccctggggcagagcgactctgcgag
gcctgggaccctctgagataccgcgtagcactggagagctgctcccaggaccacatcaca
gcactttcagccattcactctaaaactgtcttccccatgaaactgaagaggagacagaat
ctacagagcccccattcaagccggtccaccattctggtggagctggagagggagacaagt
gcagaggtcatgaactttgctccaggagaccatgttggtgttttcccagggaatctccct
caactggtggctggaatcctaaagttccttccccatacacccgcaaccaaccagtgccta
cgactggaataccgctctgactcctgccttgatgatgagaaaaactggcagactgtcaga
cgcatcccagcatgccctttgtctcaggcgctcacctacttcctggatgtgaccacgccc
ccctgtcagaacctcctccacaagctctctcagctggcaagacaggaggggcactgccag
cgtctgctgaccttggcaaaggactctcaggagtacacgacctggaagatgttccgtgtt
cccaacttcctggaagtcctggaggagttcccgtctttagaaccctctgcagccttcctc
ctcagcgagctgcccctgctcaagccccgcctctactccatcagctcctcccctcagctc
caccccaatgagctacatctcactctgacagtgctcaactatcacacacaagatggacag
ggtcctcttcaccacggggtctgcagcacctggctggataccattaagaaaggagacctg
gtactatgtttcatctacaggtgggttccacctcccagcagagcccagcactccagtcat
tctggtgggggctggcagtggcattgcgcccttccgaagcttctggcaacaacggctaca
tga

DBGET integrated database retrieval system