KEGG   Salvelinus alpinus (Arctic char): 111950058
Entry
111950058         CDS       T05762                                 

Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111950058
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:salp04052]
    111950058
Cytokines and growth factors [BR:salp04052]
 Cytokines
  CSF and other factors
   111950058
SSDB
Motif
Pfam: EPO_TPO Y_phosphatase
Other DBs
NCBI-GeneID: 111950058
NCBI-ProteinID: XP_023823159
LinkDB
AA seq 184 aa
MSSISGLVAVLLTVLQWAGRGLPSPVRPICDPRVLDRFIMEARDTETALRGCKAGCGVTG
TFVVPLTNVDFVLLETKDTEEQALEVQSGLSLFGQALGAVRESVSRAAVKSLIDNNKSNI
HSLGQVLRSLHIKDLSLSPVPAVGDSATRKVSSLSELLRVHTNFLRGKVRLLLTNAPACQ
QNST
NT seq 555 nt   +upstreamnt  +downstreamnt
atgtcttccatttcagggctggtggcggtactgctgactgtactccagtgggcagggcga
ggcctcccttctcctgtcaggcccatctgtgacccccgcgttctggaccgcttcatcatg
gaggcccgcgacacagagaccgctctgcgaggttgcaaggcagggtgtggcgtgacaggc
accttcgtggttccactgaccaacgttgactttgtgctattggagacaaaggatactgag
gagcaggctctggaggtccagtcaggactgtctctgttcggccaggccctgggtgctgtg
agggagtcagtgagccgtgctgccgtaaagagcctcatcgacaacaacaagagcaacatc
cacagcctgggccaggtgctgcgcagcctccacatcaaggacctgtccctctctccagtg
ccagcagtaggtgactcagcgaccaggaaggtgtcgtccctatccgagctcctccgtgtc
cacaccaacttcctacgggggaaggttcgcctgctgctcaccaacgcacctgcctgtcaa
cagaacagcacgtga

DBGET integrated database retrieval system