KEGG   Salvelinus alpinus (Arctic char): 111950164
Entry
111950164         CDS       T05762                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111950164
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111950164
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:salp04052]
    111950164
   00536 Glycosaminoglycan binding proteins [BR:salp00536]
    111950164
Cytokines and growth factors [BR:salp04052]
 Growth factors
  Growth factors (RTK binding)
   111950164
Glycosaminoglycan binding proteins [BR:salp00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   111950164
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 111950164
NCBI-ProteinID: XP_023823334
LinkDB
AA seq 244 aa
MDLVTLGGPWMIDGVQIQTESPRQPLHHRGQFSQETHFHRRPDTQTLRDSSNSHSGKSDR
ADMLAHLGHCNMALSQPQGHLAGTSRPEGLYRMTEGGITVLSMGPTTQQNYSPLIRLYCM
NGGHHLQILPDGTVAGNRDENKDDILKVKAVSVGVVAIKGHETGRYLAMDKDGHLYGSKT
LKDECYFLEKMEENHYNTYRSQKYQAKDWFLGLKRNGQPKAGQRTHIGQKAIYFLPRPVD
NTTM
NT seq 735 nt   +upstreamnt  +downstreamnt
atggatctggtgacgctgggcggcccctggatgattgacggagtacaaatacagacagag
tcacccaggcagccactgcaccacaggggccagttctcccaggagacccacttccacagg
aggcctgacacacagacgctgagagactcatccaattcacactcaggaaaaagcgacagg
gcggacatgctggctcatctggggcattgtaacatggcgttgtcacagccacaggggcat
ttagcaggcacatctcgtccagagggactctacagaatgacagagggaggaattactgtg
ctctccatggggccaacgacacaacaaaactacagccctctcatacggctctactgtatg
aacggaggacatcatctacagattctaccggatgggactgtcgcgggcaacagagatgaa
aataaagatgacatcctgaaggtaaaagcagtgagtgttggtgtggtggccatcaagggc
catgagacgggccgttacctggccatggacaaagatgggcatctctatggatcgaaaact
ctgaaggatgagtgttacttcctggagaagatggaagagaaccattacaacacatacagg
tctcagaagtaccaggccaaagactggttcctggggctcaagaggaacgggcagcctaaa
gctggccaaaggacacacataggccagaaggccatatattttctgcctcggcctgttgac
aacaccaccatgtaa

DBGET integrated database retrieval system