KEGG   Salvelinus alpinus (Arctic char): 111951405
Entry
111951405         CDS       T05762                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04012  ErbB signaling pathway
salp04068  FoxO signaling pathway
salp04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111951405
   04068 FoxO signaling pathway
    111951405
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111951405
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111951405
NCBI-ProteinID: XP_023825245
LinkDB
AA seq 191 aa
MCNNMSNVSLSNGSPTLERVDPRPTDHTKHRIRRNLFGSVDHDEFRRECLVQMKEMEKAS
IDKWNYDFLNDKPLSQGDYKWEPMKSSDLPDFYSRPPHKRVWPSGNVDHNGNHDYRVRPS
CPTNGAELSEETEKSERQTHCHHSHNLARKRPANPEPQSTGKKSHSSEKDAVVSKSVEQT
PSKNDSRTHEH
NT seq 576 nt   +upstreamnt  +downstreamnt
atgtgcaacaacatgtcaaatgttagtctttcgaatgggagtccgacgttggaaagggtg
gatccgcgtccgacggatcacacgaagcaccggattcgcagaaatcttttcggatcggta
gatcacgacgaatttaggagggagtgtttggttcaaatgaaagagatggagaaggcttct
attgacaaatggaattatgatttcctaaacgacaagcccctttcccagggagattataaa
tgggaacccatgaaaagcagtgacctgcctgacttttacagcagaccgcctcacaagcga
gtctggccctctggaaatgtggaccataacgggaatcatgattaccgagtccgaccgagc
tgtcctacgaacggggctgagctatccgaggagactgagaagagcgagaggcagacgcat
tgtcaccactctcacaacctggcaaggaaaagacctgcaaatccagaaccccaaagtact
ggtaaaaagtcacattcgagtgaaaaggatgcagttgtgtcaaagtcagtagaacagaca
cccagcaaaaacgattccaggacacatgaacactaa

DBGET integrated database retrieval system