KEGG   Salvelinus alpinus (Arctic char): 111951492Help
Entry
111951492         CDS       T05762                                 

Gene name
gys2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00500  Starch and sucrose metabolism
salp01100  Metabolic pathways
salp04910  Insulin signaling pathway
Module
salp_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    111951492 (gys2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111951492 (gys2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:salp01003]
    111951492 (gys2)
Enzymes [BR:salp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     111951492 (gys2)
Glycosyltransferases [BR:salp01003]
 Polysaccharide
  Storage polysaccharide
   111951492 (gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 111951492
NCBI-ProteinID: XP_023825385
LinkDB All DBs
AA seq 745 aa AA seqDB search
MPLTRSLSMTSLSGLPLWDEEDLPVDDLLLFEVAWEVTNKVGGIYTVIQTKAKITVDEWG
ENLFMMGPYYEHNFNTQVEQCEPPNPAIKKAMSALIDNGCLVYFGRWLIEGSPYVILFDT
GSAAWNLDRWKGDLWDTCGIGMPAHDKEANDSLIFGSMVAWFFKELTDELGDSPNVLAHF
HEWQVGAGLILCRSRKIPLATIFTTHATLLGRYICAGNVDFYNNLGKFNIDQEAGERQIY
HRYCLERAAVHCAHVFTTVSQITAVEANHMLHRKPDVVTPNGLNIKKFSAMHEFQNLHST
NKGRIQEFIRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGVDIFLESLSRLNYLLRVHKND
VTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHTVKDKFGKRLYEALLKGDIPDMNTI
LDRDDFTIMKRAIYATQRHTLPPVTTHNMLDDTSDPILANVRRIGLFNARTDRVKIVFHP
EFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFME
EHVSDPTAYGIYIVDRRFRSADDSCNQLTQFMFGFCQQSRRQRXIQRNRTERLSDLLDWR
YLGRFYMHARSLALSRAFPDKFKMEPLARHRQRDSVTPAPALCPPPPRRRCTPPPTTVMR
RMMTKSRMMKIRRRRGTGRTSKPHSLWVPCPRARRHTQESLPTERSLATCLGWPTLVFES
CSMWRFLFQPRTYNISSVVGTLSLK
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgacccgttccttatccatgacgtcactgagcggtctgcctctgtgggatgag
gaagatctacctgtagacgacctgctgctgtttgaggtagcctgggaggtcactaataaa
gtgggtgggatctacacagttatccagaccaaggccaagataacagtggatgaatggggg
gagaacttattcatgatggggccgtactacgaacacaactttaacacccaggtggagcag
tgtgagccccccaacccagccatcaagaaagcaatgagcgccctcattgacaacggctgc
ctggtgtactttgggcgctggctgatcgagggcagtccctatgtgatcctatttgacacg
gggtcagcagcctggaacctggaccgatggaagggggatctgtgggacacctgtggtatc
ggcatgcccgcccatgacaaagaggccaacgactcactcatcttcggatccatggttgcc
tggttctttaaagagttaaccgacgagcttggagactcgcccaatgtcctcgcccatttc
catgagtggcaggtaggggcaggacttattctctgtcgctcacggaagattcccttggca
accattttcacaacccatgccactctgttgggaagatacatctgtgccggaaatgttgac
ttctacaacaaccttggcaagttcaacatagaccaggaggctggtgagaggcagatctac
catcgctactgtctggagagagctgctgtccactgtgcccatgtctttacaactgtatcc
cagatcactgctgtagaggctaaccacatgctgcacaggaaaccagatgtggtgactcca
aacggattgaacatcaagaagttctcagccatgcacgagttccagaaccttcattccact
aataagggccggattcaggaattcatcaggggacacttctatggtcatctggacttcaat
ctggagaaaactctcttcttctttattgctggacgatatgagttctccaacaagggagtt
gacatcttcctggagtcactgtccagactcaactatctgctaagggtgcataagaatgac
gtcacagtggtggtgttcttcatcatgccagccaagaccaacaactttaacgtggagacg
ctgaagggtcaggcggtacgcaaacagctctgggacactgctcacactgtgaaagataag
tttggcaagaggctttatgaggcattgttaaaaggagacatccctgatatgaacaccatc
ctggacagagacgacttcaccatcatgaagagagccatctatgccacacagagacacacc
cttcctccagtgaccactcacaacatgctggatgacacctccgaccccatcctggccaac
gtgagacgcatcggcctcttcaacgctcgcactgaccgagtcaagatagtgttccaccca
gagttcctgtcgtccaccagtcccctgcttcctatggactatgaggagtttgtacgaggc
tgtcacctgggggtcttcccttcttactacgagccctggggatacacaccaggtgagtgt
actgtgatggggatacccagtgtgaccaccaacctgtctggcttcggctgcttcatggag
gaacatgtgtcagaccccacggcatacgggatctacatagtggaccggcggttccgctcg
gcagatgactcgtgtaaccagctgacccagttcatgttcgggttctgccagcagtccaga
cgacagcgcatsatccagaggaaccgcacagagagactgtcggacctgctggactggagg
tacctgggacggttctacatgcacgcccggagcctggctctcagcagggctttccctgac
aagttcaagatggagccgctggcccgccacagacagagggattccgttacccccgccccg
gctctgtgcccccctccccctcggcgtcggtgcactccaccccccaccacagtgatgagg
aggatgatgacgaagagccgtatgatgaagataaggaggcggagagggacaggcagaaca
tcaaagccccattcactctgggtgccatgcccgagggcaagaagacacacccaggagagt
ctgccaactgaaagatctctcgctacttgcctgggatggccaaccctggtctttgagagc
tgcagtatgtggaggtttttgttccagcccagaacgtacaatattagctctgttgtaggg
acactgagtctcaagtag

DBGET integrated database retrieval system