KEGG   Salvelinus alpinus (Arctic char): 111952420
Entry
111952420         CDS       T05762                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04068  FoxO signaling pathway
salp04110  Cell cycle
salp04115  p53 signaling pathway
salp04218  Cellular senescence
salp04310  Wnt signaling pathway
salp04340  Hedgehog signaling pathway
salp04371  Apelin signaling pathway
salp04510  Focal adhesion
salp04530  Tight junction
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111952420
   04340 Hedgehog signaling pathway
    111952420
   04371 Apelin signaling pathway
    111952420
   04068 FoxO signaling pathway
    111952420
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111952420
   04115 p53 signaling pathway
    111952420
   04218 Cellular senescence
    111952420
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111952420
   04530 Tight junction
    111952420
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 111952420
NCBI-ProteinID: XP_023826834
LinkDB
AA seq 291 aa
MEHQLLCCEVETIRRAYQDSNLLNDRVLQTMLKAEDNYLPATNYFKCVQKEIVPCMRRIV
STWMLEVCEEQKCEEEVFPLAMNFLDRYLSVEPTKKTRLQLLGATCMFLASKMKETIPLT
AEKLCIYTDNSIRTGELLQMELLVLNKLKWDLASVTPHDFIDHFLSKLPIHQDTKQILCK
HAQTFVALCATGISFANPPSMIAAGSVAAAVQGLNLKSMDDALSSQQLTDFLSQVIRSDP
DCLRACQEQIESLLETSLRQAQQHTVSTDTKSMDEEVDLSCTPTDVRDVNI
NT seq 876 nt   +upstreamnt  +downstreamnt
atggaacaccagttgctgtgctgtgaagtggagaccatccggagagcttaccaagactcg
aacctgctcaacgacagagttctgcagactatgctaaaagctgaagacaattatctcccc
gcaacgaactacttcaaatgtgtacagaaagagattgtaccctgcatgaggagaattgtt
tctacatggatgctggaggtctgtgaggaacagaaatgcgaagaggaggtttttccccta
gctatgaattttttagacagatatttgtctgttgaacccacgaagaagactcggctacag
ttattgggcgctacatgcatgtttctggcgtctaaaatgaaggagaccattcctctaaca
gctgagaagttgtgcatatacacagacaattccatccggacgggcgagttgctgcaaatg
gaactactggtattgaacaaactgaaatgggatctagcctcagttactccacacgatttc
atagaccacttcctctccaagctacccatccatcaggacaccaagcaaatcctgtgcaag
catgcccagacatttgtggccctctgtgctacaggtatttcatttgccaaccctccgtca
atgatcgcagcgggcagtgtggcggctgctgtccaggggctgaatctgaagagcatggac
gatgcactttcatcccagcaactcactgacttcctgtctcaagtcatcagaagtgacccg
gattgtctacgggcgtgtcaagaacagatcgagtccttattggagaccagtctccgtcag
gcacaacaacacaccgtttccacggacaccaagagcatggacgaggaggtcgacctgtcg
tgcacgccaacggacgttagagatgtgaacatctga

DBGET integrated database retrieval system