KEGG   Salvelinus alpinus (Arctic char): 111952941
Entry
111952941         CDS       T05762                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111952941 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111952941 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:salp04052]
    111952941 (kitlg)
Cytokines and growth factors [BR:salp04052]
 Growth factors
  Growth factors (RTK binding)
   111952941 (kitlg)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 111952941
NCBI-ProteinID: XP_023827744
LinkDB
AA seq 258 aa
MKKSKIWIRICVHLLLCTTFGVHSSEFGDAVTDDITSISLLKQNIPKDYKIPVTYIPKEV
GGMCWVTLNVFHLELSLRGLADKFGNISSNKYNISILIEMLKETRYHMKNLEVITSDFEC
HYRDEKWQTGHYFQFVEDFLKTARSNRDSPEECDPPPCPTTTTKASATTITTQYPTSGKE
PLRFLPEVVERSLLSLLVIPIAAIVFLFVWKVKSRSNQHQSDELKSVEGGLFTGTEESLA
PPLDDISEKNRLNIIETV
NT seq 777 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaatttggatacgcatctgtgtccatttattgctgtgcaccacattt
ggagttcactcaagtgaatttggagatgctgtaacagatgacatcacaagcatttcacta
ttgaaacaaaatatacctaaagattacaagattccagtgacatacattccaaaagaagtg
ggtggaatgtgttgggtcacgctaaatgttttccacttggaactcagtttacgaggattg
gcagacaagtttggaaacatttcttccaacaaatataatatcagcatattgatcgaaatg
ctgaaagagacgcgatatcacatgaagaacttggaggtgatcacgtctgattttgagtgc
cactatagagacgagaaatggcagacaggacactattttcagtttgttgaagattttcta
aaaacggcccgttcgaatagagattcgccagaagaatgcgatccacctccctgtccaaca
acaacaacaaaggcatcagcaactacaataacaacacaataccccacatcagggaaagag
cctctgaggttcctgccagaagtagtggagagaagcctcctgtcactacttgtaattcct
attgcagccatcgtgtttctgtttgtgtggaaggtgaaatccaggagcaaccaacatcaa
tcagatgaactgaaatcagtggaaggaggcctcttcacaggaacagaagagagtttggca
cctccactcgacgacatttctgaaaagaacagattgaacatcattgagacagtgtaa

DBGET integrated database retrieval system