KEGG   Salvelinus alpinus (Arctic char): 111955063
Entry
111955063         CDS       T05762                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04141  Protein processing in endoplasmic reticulum
salp04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:salp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111955063
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111955063
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:salp03000]
    111955063
Transcription factors [BR:salp03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111955063
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA bZIP_Maf MCU DUF724 DUF4140 CENP-H
Other DBs
NCBI-GeneID: 111955063
NCBI-ProteinID: XP_023830886
LinkDB
AA seq 707 aa
MTTDLLSDLESRFFADNLLTSEDWDACLYQCESMEEGEDGEYTRGPKYETSFDNDLVLTL
DPDNPTSPWRHLDDNLLTGDSPVLKDKMTITQPLPVDMLFRVKAEPPSPASSLASDCSLT
SLPDSQITVKGENPPTPPYMFGDVLSPPLGTCEVTVASAPQAQPQXHLLPQPQQHQTAAN
NGINALATVHPTAATIKASTILSSKPSIQPRPVCLAALPVPQAPSPAKALILHSLPSMDQ
SRPVVLSQSVCLGSTPAIVKMEPVSPTMPHGHSPTAPFPSKPIVPASSLPGSNGIDVSVC
QSHVSQSMKVMKRQQRMIKNRESACQSRKKKKEYLQNLEGQLREAQQENERLRRENQALR
ERLVGKEGSESGNNKRAVCVMAVLLFMTFSFGPVSITDRKLETGLQEEVVPHAGRRLLEF
ETAQEHSRVEERMDPEEEEEGGEDGWKGGEVERESTDSYQFRNLSDVFSDVKDLVLQDID
RYFTSNDCRQFNRSESLRLADELRGWVHRHQIDRKKSGGKPKMVKKAKIAQKAQLRKTNF
SRYLPIQTHRSIESQIQVFPAGAEISYSDFMDAIDRREDTFYVVSFRRDHLLLPAISHNK
TTRPKMSLVMPAMSVNESLYNKSQGYEMMMQVDCEVMDTRIIPIKASAVPPSLRDPPPAP
PAHHHHSNHTSLRGRHHPHTGRAESPRQPLAIRRREAEYYISQGGQV
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgactacggatttactatctgatttggaaagtcgtttcttcgctgataaccttctgaca
agcgaagaytgggatgcctgtctgtaccagtgtgagagcatggaggagggagaggacggg
gagtacacgagaggaccgaaatatgaaacctcgtttgacaaygatctcgtgctgactctt
gatcccgacaatcccacgtcgccgtggagacacctggacgacaaccttctcacaggggac
agtcccgtattgaaagataaaatgaccataacgcagcctttgccagtggacatgttgttc
cgggtgaaggcggagcctccctcccctgcctcctcgctggcctcagactgctccctgacg
tcactcccagactcacagatcacagtgaaaggggagaacccgcccacacctccttatatg
tttggagatgtgctgtcgccaccacttggcacatgtgaagtcacggtggcctccgcgcca
caggcccaaccacagkcccatttgctcccacagccacagcaacaccaaacagcagccaac
aatggcatcaacgcacttgccacagttcaccccactgcggccaccatcaaagccagtacc
atcctgagcagtaagccttccatccagcccaggcctgtgtgtttagcggctctccccgtc
ccccaggctcccagtccagccaaggccctcatactgcacagcctgcctagcatggaccag
agcaggcctgtggtgctttcccagtctgtctgtctggggtccactccagccatcgtcaaa
atggagcctgtctctcccaccatgcctcacggccatagccccacagccccattccccagc
aaacccatagtcccagcgtcctctctgccagggagcaatggcattgatgtgagtgtctgt
cagtcacatgtcagtcagtcaatgaaggtgatgaagaggcagcagaggatgatcaagaac
cgggagtcggcgtgccagtcacgcaagaagaagaaggagtacctgcagaacctggagggg
cagctgagggaggcgcagcaggagaacgagcgcctccgcagggagaaccaggccctgagg
gagaggcttgtcgggaaagagggcagtgagtctggtaacaataagagggccgtctgcgtc
atggcagtgctactattcatgacmttcagtttcggccctgtcagtatcacagacaggaag
ctggagacgggattacaggaggaggtggtgcctcacgcaggaagacgtctcctggagttt
gagacggctcaggaacacagcagagtggaggaaaggatggatcctgaggaggaggaggag
ggaggagaggatgggtggaagggaggagaggtggagagggaatccaccgattcrtaccag
tttaggaacctgagtgacgtgttcagcgacgtgaaggatttggtcctgcaggacatcgac
cgctatttcacctccaatgactgcaggcagttcaaccgttccgagtccctcaggctggcg
gatgagctgagaggatgggttcacaggcaccagatcgacaggaagaagtctggagggaag
ccaaagatggtgaaaaaagctaaaatagcgcagaaagcacagctaaggaagacgaacttc
tccagatatcttcccattcagacccatcgttccatcgagagtcagatacaagtgttccct
gccggtgccgagatcagctacagtgacttcatggacgccatcgaccggcgtgaggacacc
ttctacgtggtctccttcagacgggatcacctgctgttgcctgccatcagccacaacaag
accacacggcccaaaatgtctcttgtgatgccggctatgtctgtcaacgagagtttatat
aacaaatcccaggggtatgagatgatgatgcaggtggattgtgaggtcatggacacccgg
atcatccccatcaaagcctccgctgttcccccgtccctccgcgacccccctcctgctccc
cccgcccaccatcaccacagcaaccacacctccctccgaggccgccaccatccccacacc
ggcagagcggagtctccacggcaacccttagctatcagaagacgggaggccgagtattac
atcagccaggggggccaggtttga

DBGET integrated database retrieval system