KEGG   Salvelinus alpinus (Arctic char): 111955634
Entry
111955634         CDS       T05762                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04141  Protein processing in endoplasmic reticulum
salp04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:salp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111955634
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111955634
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:salp03000]
    111955634
Transcription factors [BR:salp03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111955634
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA HAUS6_N ATP-synt_B MCU DUF4140 CENP-H
Other DBs
NCBI-GeneID: 111955634
NCBI-ProteinID: XP_023831624
LinkDB
AA seq 756 aa
MTTDLLSDLDSRFFADNLLTSEDWDACLYQCESMEEGEDGEYTRGPKYETSFDNDLVLTL
DPDNPTSPWRHLDDNLLTGDVPVLKDEMTITQPLPVDMLFRVKAEPPSPASSLASDCSLT
SLPDSQITVKGENPPTPPYMFGDVLAPPLGTCEVTVASAQLARPQSKLPXQQHQTATHNG
MDTQAQATVHPTAXTIKASTILSSKPLIQPRPVCVAALPVSQAPSPAKALILHSLPSRDQ
SRPVVLSQSVCLGSAPAIVKMEPVSPTMPHCHSPTAPFPSKPIVPASSLPGSNCNGMDVS
VCQSHVSQSVSISLSRSSSTAALPRASLSDHTPSSAVINCHALSPPTGSQMKVMKRQQRM
IKNRESACQSRKKKKEYLQNLEGQLREAQQENERLRKENQALRERLAGKEGSESGNNKRA
VCVMAVLLFMTFSFGPVSITDRKLETGLQEEVVPHTGRNLLEFETAREHSRVEERLDPEE
EGGEDGWKGGEVERESTESYQFRNLSDVFSDVKDLVLQDIDRYFTSNDCRQFNRSESLRL
ADELRGWVHRHQIDRKKSGGKPKIVKKAKIAQLFPFPFLQKAQLRKTNISRYLPIQTHRS
IDSQIQVFPAGPEISYSDFMDAIDRREDTFYVVSFRRDHLLLPAISHNKTTRPKMSLVMP
AMSVNESLYNKSQGYEMMMQVDCEVMDTRIIPIKASAVPPSLRDPPPAPPXHHHHSNHTS
LRGRHHPHTGGAASPRQPLPARRQEAEYYISQGGGV
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgactacggatttactatctgatttggatagtcgtttcttcgctgataaccttctgaca
agcgaggattgggatgcctgtctgtaccagtgtgagagcatggaggagggagaggacgga
gagtacacgagaggaccgaaatatgaaacatcgtttgacaacgatctcgtgctgaccctt
gatcctgacaatcccacgtcgccatggagacacctggacgacaaccttctcacaggggac
gttcccgtattgaaagatgaaatgacgataacgcagcctttgccagtggacatgttgttc
cgggtgaaggcggagcctccctcccctgcctcctcgctggcctccgactgctccctgacc
tcactcccagactcacagatcacagtgaaaggagagaacccgcccacgcctccttatatg
tttggagatgtgctggcaccaccacttggcacatgtgaagtcacggtggcctctgcacaa
ctggcccgaccacagtccaaactgccgrctcagcaacaccaaacagcaacccacaatggc
atggacacacaggcacaggccacagtccaccccactgcgyccacgatcaaagccagtacc
atcctgagcagtaagcctctcatccagcccaggcctgtgtgtgtagcggctctccccgtc
tcccaggctcccagtccggccaaggccctcatactgcacagcctgcctagcagggaccag
agcaggcctgtggtgctttcccagtcagtctgtctggggtcrgcgccagccatcgtcaaa
atggagcccgtctcccccaccatgcctcactgccatagccccacggccccattccccagc
aaacccatagtcccggcgtcctctctgccagggagcaactgcaacggcatggatgtgagt
gtctgtcagtcgcatgtcagtcagtcagtgagtatttctctttcacgctcttcttcaacc
gctgccttaccccgggcttcactgtcagatcacacgcccagttctgccgtgattaactgt
catgcgctctcccctccgaccgggtctcagatgaaggtgatgaagaggcagcagcggatg
atcaagaaccgggagtcggcgtgccagtcacgcaagaagaagaaggagtacctgcagaac
ctggagggccagctgagggaggcgcagcaggagaacgagcgcctccgcaaggagaaccag
gccctgagggagaggcttgccgggaaagagggcagtgaatctggtaacaacaagagggcc
gtctgcgtcatggcagtgctactgttcatgaccttcagtttcggccctgtcagtatcaca
gacaggaagctggagacggggttacaggaagaggtggtccctcacacaggaagaaatctc
ctggagtttgagacggctcgggaacatagcagagtggaggaaaggctagatcctgaggag
gagggaggagaggatgggtggaagggaggagaggtggagagggaatccaccgartcatac
cagtttaggaacctgagtgacgtgttcagcgacgtgaaggacctggtcctgcaggacatc
gaccgctatttcacctccaatgactgcaggcagttcaaccgctccgagtccctcaggctg
gcggatgagctgagaggatgggtccacaggcaccagatcgacaggaagaagtctggaggg
aagccaaagattgtgaaaaaagctaaaatagcgcagttgtttcccttcccttttctacag
aaagcgcagcttaggaagacaaacatctccagatatcttcccattcagacccatcgttcc
attgacagtcagatacaagtgttccctgctggtccagagatcagctacagtgacttcatg
gacgccatcgaccggcgtgaggacaccttctacgtggtctccttcagacgggatcacctg
ctgttgccagctatcagccacaacaagaccacacggcccaaaatgtctctggtgatgcca
gctatgtctgtcaacgagagtttatataataaatcccagggctatgagatgatgatgcag
gtggattgtgaggtcatggacacccggatcatccccatcaaagcctccgctgttcccccg
tccctccgcgacccccctcccgctccccccycccaccatcaccacagcaaccacacctcc
ctccgaggccgccaccatccccacaccggcggagcggcgtctccacggcaacccttacct
gccagaagacaggaggccgagtattacatcagccaggggggcggggtttga

DBGET integrated database retrieval system