KEGG   Salvelinus alpinus (Arctic char): 111955807Help
Entry
111955807         CDS       T05762                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00020  Citrate cycle (TCA cycle)
salp00190  Oxidative phosphorylation
salp01100  Metabolic pathways
salp01200  Carbon metabolism
Module
salp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
salp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
salp_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111955807
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111955807
Enzymes [BR:salp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111955807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 111955807
NCBI-ProteinID: XP_023831891
LinkDB All DBs
AA seq 661 aa AA seqDB search
MAAVCTASRVLAKKVLSAKALPAISQSSRKLHFSVYGQNNSKVSDGMSTQYPVVDHEFDA
VVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEGDDWRWHFY
DTVKGSDWLGDQDAIHYMTEQAPHAVVELENFGMPFSRTEDGKIYQRAFGGQSLKFGKGG
QAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECKGVIALCMEDGSI
HRFRSKNTVIATGGYGRTYFSCTSAHTSTGDGNAMVTRAGLPCQDLEFVQFHPTGIYGAG
CLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSITIEIREGRGCGPEKDHA
YLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYRGQVITH
TSEEGDKVVPGLFACGEAACASVHGANRLGANSLLDLVVFGRACAHTITDICTPGEKLSP
LKPNAGEESVANLDKLRFADGNIRTSEIRVNMQKTMQNHAAVFRTGKVLKEGCDKMDAVY
HTLDDIKTFDRGIVWNTDLVETLELQNLMLNAVQTINSAEQRQESRGAHSREDFKDRMDE
LDYARPLAGQVKKPIEEHWRKHTLSTVDPKTGKVTLSYRPVIDHSLDAEDCAAIPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggtgtgtactgcctcccgtgtcctcgccaaaaaggtgctgtcagccaaggcg
cttcctgcaatatcccagagctccaggaagctccacttctcagtctatgggcagaacaac
tctaaagtatcagatggcatgtccacacagtacccggtggtagaccatgagtttgatgca
gtggttgtgggtgccggcggagcagggctgcgtgctgctttcggtctgtctgaggctggc
ttcaacacagcttgtgtcacaaagctgttccccaccaggtcacacacggtggctgcacag
ggtgggatcaacgcagcccttggaaacatggagggagatgattggaggtggcacttctac
gatacggtgaagggatctgattggctgggagaccaggatgccatacactacatgacagag
caggctccacatgctgtggtggagctggagaactttggtatgcccttcagtcgtaccgag
gatggtaaaatctaccagagggcttttggaggccagagtctgaagtttggcaagggaggc
caggcccaccggtgctgctgcgtagctgacagaactggccactccctcctgcacacactc
tacggacgatctctgaggtatgacaccagctactttgtggagtactttgccctggacctg
ctgatggaggatggcgagtgcaagggagtaattgctctgtgtatggaggacggatcgatc
caccgcttcagatccaagaacacggtcattgccacaggtggttatggccgtacctacttc
agctgcacctccgcccacaccagcacaggagacggtaatgccatggtgacccgtgcaggc
ctgccctgccaagacctggagtttgtccagttccaccctacaggcatctatggagccggc
tgtctgattacagagggttgccgtggtgagggaggaatcctcatcaacagtgagggtgag
cgctttatggagcggtacgctcctaacgccaaggacctggcctccagagacgtggtgtcc
cgctccattaccatcgagattcgagagggcaggggatgtggcccagagaaagaccatgca
tacctgcagctgcaccatctccccccacagcagttggccactcgtctacccggcatctct
gagaccgccatgatcttcgccggcgtggacgtcaccaaagagcccatcccrgtcctgccc
actgtacactacaacatgggaggaatccccaccaactacaggggacaggtcatcacccat
acgtccgaggagggtgataaggtggtgccagggctgtttgcctgtggcgaggctgcctgt
gccagtgtccatggtgccaaccgtctgggagccaactccctgttggatctggtggtgttt
ggacgcgcctgcgctcacacaatcactgacatctgcactccaggagagaagctctccccc
ctgaagcccaacgcaggagaggagtctgtggccaacctggacaagctgaggtttgctgat
ggcaacataaggacctctgagatcagagtgaacatgcagaagaccatgcagaaccacgcr
gctgtgttccgtaccggcaaggtcctgaaggagggatgtgacaagatggacgccgtctac
cayaccctggacgacatcaagaccttcgacagaggtattgtgtggaacactgacttagtg
gagaccctggagctgcagaaccttatgctgaacgctgtgcagaccatcaactctgccgag
cagcgccaggagagcaggggagcccactccagagaggacttcaaggaccgtatggatgag
cttgactacgccaggcctctggcgggacaggtgaagaagcccattgaagagcactggagg
aaacacaccctgtccactgtggatccaaagaccgggaaggtaactctgagctacagaccg
gttattgatcactcactggatgcagaggactgtgctgctatccctcccgccatccgttcc
tattaa

DBGET integrated database retrieval system