KEGG   Salvelinus alpinus (Arctic char): 111956220
Entry
111956220         CDS       T05762                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04060  Cytokine-cytokine receptor interaction
salp04068  FoxO signaling pathway
salp04144  Endocytosis
salp04218  Cellular senescence
salp04350  TGF-beta signaling pathway
salp04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111956220
   04350 TGF-beta signaling pathway
    111956220
   04068 FoxO signaling pathway
    111956220
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111956220
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111956220
  09143 Cell growth and death
   04218 Cellular senescence
    111956220
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111956220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    111956220
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     111956220
Protein kinases [BR:salp01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   111956220
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal
Other DBs
NCBI-GeneID: 111956220
NCBI-ProteinID: XP_023832441
LinkDB
AA seq 571 aa
MELLRFSAFWCGTILFGSVLLEQKGVSSMNMLKLKLLCKFCDVESTSCTGTGSCMTDCGI
TSICPHPEDVCVSIWRKRVDNVTIDTICHNPAHKLHGLVLEGYNNSKCEMRERNGMGSQF
FICSCSEDECNNHVFFTPYSLDSQVVSVILVSLVPLLVLAMLVITSFYWYRIYHQRHAGA
KRKKTPLDFSDGRAIMMDDDGSDSSSTHANNLNHNTELLPIELDSQVGKGRFAEVYKAKL
KQGATGAGEPFETVAVKIFADEEYASWKNEKDIFSDADLRHENVLHFLTAEERKVEKQYW
LITAYHPQGNLQEYLTRHVISWDDLWVLGGSLARGVAHLHSDHTLCGRYKVPIVHRDIKS
SNILVKGDLTCVLCDFGLGLRLDNSLSVDELANSGQVGTARYMAPEVLESRINLENIESF
KQTDVYSMALVLWEITSRCNAIGEVKDYEPPFGKVREHPCVESMKDSVLRDRGRPEIPSS
WINHPGIQVVCGTIDECWDHDPEARLTAQCVAERFNDMEHPDKLSGRSNSEEKIPQDISV
TEFEEIEKKEVCLRNYNAPAGEAENYNQPSS
NT seq 1716 nt   +upstreamnt  +downstreamnt
atggagctacttcggttttctgctttctggtgtggaacgatactctttggtagtgttctg
ctagaacagaagggggtctcgtcaatgaacatgctgaagctgaagcttctgtgtaagttc
tgtgacgtggagtctaccagctgtacgggcacagggagctgtatgaccgactgtggcatc
acatccatctgcccccatccagaggacgtgtgtgtcagcatttggagaaagagagttgac
aacgtcaccatagacacgatatgccacaacccagcccataagctgcatggtctggtgctg
gagggctataacaacagcaagtgtgagatgagggagaggaatggcatgggctcccagttc
ttcatctgctcctgctccgaggacgagtgcaacaaccacgtgttcttcactccctactct
cttgactcccaggtggtgtcggtgatcctggtcagcctggttcctctgctggttctggcc
atgctggtcatcacatccttctattggtaccgcatctaccaccagcgccacgccggtgcc
aagcgcaagaagacgccgctcgacttcagcgacggccgcgccatcatgatggacgacgac
ggctcggacagcagctccacgcacgccaacaacctcaaccacaacacggagctcctcccc
atcgagctggactcccaggtgggcaagggccgcttcgctgaggtctacaaggccaagctg
aagcagggcgccacgggagccggtgagcccttcgagaccgtcgccgtcaagattttcgcc
gatgaagagtatgcctcgtggaagaacgagaaggacatcttctcggacgctgacctgcgc
cacgagaacgtcctgcacttcctgacagcggaggaacgtaaggtggagaaacagtattgg
ctgatcacggcctaccacccccagggcaacctccaggagtacctgacgcgccacgtcatc
agctgggacgacctgtgggtgctgggcgggtcgctggcgaggggcgtggcccacctgcac
agtgaccacacgttgtgcggacgctacaaggtgccaatcgtccaccgggacatcaagagc
tccaacatcctggtgaagggggacctcacctgcgtcctgtgtgactttggcctgggtctg
cgtctggacaactcgctgtctgtggacgagctggccaacagtggacaggtgggcactgcc
aggtacatggcccctgaggtgctggagtccaggatcaacctggagaacatcgagtcgttc
aagcagacggacgtctactccatggccctggtactgtgggagatcacctccaggtgcaac
gccattggagaggtaaaggactacgagccccccttcggtaaggtgagggagcacccgtgt
gtggagagtatgaaggacagcgttctcagagacaggggacgaccagagatccccagcagc
tggatcaaccacccaggcattcaggtggtgtgcggcacgatagacgagtgctgggaccac
gaccccgaggccaggctgactgcacagtgtgtggccgaacgcttcaatgacatggagcac
ccagacaagctgtctggacgcagcaactcagaggagaagattccccaggacatctctgtg
acggagtttgaagagattgagaagaaggaagtatgcctcagaaactacaatgcccctgct
ggggaggctgagaactacaatcaaccaagcagctga

DBGET integrated database retrieval system