KEGG   Salvelinus alpinus (Arctic char): 111956751Help
Entry
111956751         CDS       T05762                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type-like isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00010  Glycolysis / Gluconeogenesis
salp00030  Pentose phosphate pathway
salp00051  Fructose and mannose metabolism
salp00052  Galactose metabolism
salp01100  Metabolic pathways
salp01200  Carbon metabolism
salp01230  Biosynthesis of amino acids
salp03018  RNA degradation
Module
salp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111956751
   00030 Pentose phosphate pathway
    111956751
   00051 Fructose and mannose metabolism
    111956751
   00052 Galactose metabolism
    111956751
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    111956751
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:salp01009]
    111956751
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:salp03019]
    111956751
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     111956751
Protein phosphatases and associated proteins [BR:salp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111956751
Messenger RNA biogenesis [BR:salp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     111956751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 111956751
NCBI-ProteinID: XP_023833092
LinkDB All DBs
AA seq 783 aa AA seqDB search
MAKQQDTKKLFENLSGAGKSIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIHEGYQG
MVDGGDNIEEASWESVSSMLQVGGTVIGSARCKEFRSHEGRLKAAHQLVLRGITNLCVIG
GDGSLTGANLFREEWSGLLEELVRQGLIDEEAAQNNSELHIVGMVGSIDNDFCGTDMTIG
TDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPED
GWEEHMCQKLSENRADKKRLNIIIVAEGAIDCHNKPITTNHIKELVVSCLGFDTRVTILG
HVQRGGTPSAFDRILASRMGVEAVLALLEASDSTPACVVSLCGNQAVRLPLMECVQMTQD
VQKSMDDKNFEEAVRLRGRSFENNLNTYKLLSYHKADSELPNSSFNVAVLNVGAPAAGMN
AAVRSAVRVGIKEGHKMFAVNDGFEGFYKGQIKEITWGDVAGWTGQGGSILGTKRTLPAK
HLDKIAEQIRIHNINALLVIGGFEAFECLLQLYEARTSHEDFCIPMCVLPATISNNVPGT
DLSIGADTSLNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLASVGGLAAGADTVYIY
EEPFNIRDLQSNVEHLTEKMKTGIQRGLVLRNENSNENFTTDFIYQLYSEEGKGVFDCRK
NVLGHMQQGGAPSPFDRNFGTKIAAKAIQWISRKLKESYKDGKVFANTEDTACLLGMRRR
TMAFQPVVQLKDETDFAHRIPKEQWWLKLHPLMKILAKYKTSYDVSDSGQLEPVTRVRPK
KAD
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcagcaggacacaaagaaattatttgagaatctctctggcgccgggaaatcc
atcggcgttctgacaagtggaggagatgctcaaggtatgaatgctgctgttcgggctgtg
gtccgcatgggtatttatgtgggagctaaagtctacttcatccatgagggttaccagggt
atggtagacggtggagataacattgaagaggcatcatgggaaagtgtctccagcatgtta
caagtgggtggcacagtcattggcagtgcccgctgcaaggagttccgcagccacgagggg
cgtctaaaggctgcccaccaactggttctgcgtggcatcaccaacctgtgtgtgatcgga
ggggacggtagcctcacgggggccaacctcttcagagaggagtggagcggactactggaa
gaacttgtccgacagggtctgattgatgaggaggctgcccagaacaactcagagctgcac
atcgtgggaatggtgggatccattgacaacgacttctgtggcactgacatgaccatcggg
acagactctgccctgcacagaatcatagaggtggtagacgccatcatgactactgcacag
agccaccagaggacgtttgtgctagaggtcatgggaaggcattgtgggtacctggctcta
gtcagtgctctggcctgtggggccgactgggtcctgatccctgagatgccccctgaggat
ggttgggaggaacatatgtgtcagaaactatctgagaaccgtgcagataagaaacggctc
aatatcattattgtagctgagggggcgatagattgccacaacaagcctatcactacaaac
catattaaggaactagttgttagctgtctggggtttgacacccgagtcaccatcctgggt
cacgtccagagaggaggaaccccctctgccttcgacaggatcctagccagtcgtatggga
gtggaggcggtcctggccctgctggaggcgtcagacagtaccccggcctgtgtggtgtct
ctgtgtgggaaccaggctgtccgtctgcccctcatggagtgtgttcaaatgacacaagat
gtccagaaatccatggacgataagaattttgaggaagccgtgagactgcgtgggaggagt
ttcgaaaacaacctgaacacctacaaactcctctcttaccacaaagcagactctgaactc
ccaaatagctccttcaacgtggctgtgctgaacgtgggtgcccccgcggcgggcatgaac
gcagctgttcgctctgccgtcagggtgggcatcaaagaggggcacaagatgtttgccgtt
aatgacggcttcgagggattctacaagggacagataaaggagattacatggggagatgta
gcaggttggaccggccaaggggggtccatactgggaacaaagagaacccttccagcgaag
catcttgataagatcgctgaacaaatcaggatacataacatcaatgctttgcttgttatc
ggtggattcgaggcgtttgagtgtctgctgcagctctatgaggcccggaccagccatgag
gacttttgcatcccgatgtgtgtgctgcctgccaccattagtaacaatgtgcccggtact
gatctgagtatcggggcagacacttccctcaatgccatcgtggagacatgtgaccgcatc
aagcagtctgccagtgggactaagcggcgtgtgttcatcattgagaccatgggggggtac
tgtgggtacctggcgagtgtcggggggctggctgcgggggctgacactgtctacatctat
gaggaacccttcaacatcagagacctccagtccaacgtcgagcacttgacagagaagatg
aagacggggatccagagaggcttggtgctgaggaatgagaactccaacgagaacttcacc
acagacttcatctaccagctgtactctgaggaggggaaaggagtgtttgactgtaggaag
aacgtgcttggacatatgcagcagggaggtgctccttctccatttgacaggaactttgga
acgaagattgcagcaaaagcaattcagtggatttcaagaaagctaaaggagtcctataaa
gacgggaaagtgttcgctaacacagaggacacggcctgtttgctggggatgcgtcgcaga
accatggccttccaaccagtagtgcagctgaaagatgagacagactttgcccacaggatc
cctaaggaacagtggtggttgaagcttcaccccctgatgaagatcctggctaagtacaag
accagctacgatgtgtctgactctggccagctggagccagtgacccgggtcaggcccaag
aaggcagactga

DBGET integrated database retrieval system