KEGG   Salvelinus alpinus (Arctic char): 111957006Help
Entry
111957006         CDS       T05762                                 

Definition
(RefSeq) zinc finger CCHC domain-containing protein 2-like
  KO
K22700  Zinc finger CCHC domain-containing protein 2
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    111957006
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 111957006
NCBI-ProteinID: XP_023833483
LinkDB All DBs
AA seq 598 aa AA seqDB search
MLLSAPAAFRQRLEVCRFLLPHCSHYNTVPPGKTCKAPEHLKXDCTEPSSQDHDIGSHHL
GHQTACSSKSLGQSTLMTKGSQREIQRHAVHSEHNGVMERRRKPGIMTCRPDPHQNADKK
WAFTPEKKSRRRPGGRRSDGAKGYIPSSIIRPQSTHMTRQGAKPVQNKYGDTWSDSSSTP
SSPQHEAHESLDNEDLEDERDTAESYSDHSVQEKRASDHSRGEVVATVHAIVPVPHREEP
SYTGSPLSVHPLSMTVQNGQTMTDRTVMVTPQPGDGSPADGALTGTTPMVPQESIPSQAP
LGDSERQRHVSAPLSSSQLANAGSSIHLMPQCYMTPTSPESRSTNPHHQPPMSVISVILL
TFHMSPLRPAYTSTDPASTATLALAASLPDPSTRTQALAAPTSLPTPTSVTPSSGATVTP
AAISQVQATLPPAVPTHTPGPVASPALTLIHSTAQGDGTSCSNSGVAAGQAQTQQKPQPQ
QQAHPPQQQQMSCNSCGCRGSCGNSHSAAPNPNFSFPPQLXRQVFSNAHLPLFHLPSMCS
TGYPSHRSQVQHQSNATTFLPPSTSHSHPHLLATSTPPPPHAGHPGWIQPAADGSCSL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgtcagcaccagcagccttcaggcagagactagaggtctgcaggtttctcctc
ccacactgcagccactataatacagtacctcctggaaagacctgtaaggcacctgagcac
cttaaaraagactgcactgagccatccagtcaggaccatgacataggttctcaccaccta
gggcatcagacggcgtgcagcagcaagagcctaggccagagcacactgatgacaaagggc
agccagagggagattcagaggcatgctgttcactcagagcacaatggagtgatggagagg
aggaggaaaccaggcatcatgacctgtaggccagacccacatcagaacgcagataagaaa
tgggctttcactccagaaaaaaagagtagaagaagacctggtggaaggagaagtgatggg
gctaaaggctacatccccagcagcatcatcagaccacagtcaacacacatgaccagacag
ggtgccaagccggtccagaacaagtatggagacacgtggtccgatagctccagtactccc
tccagtccccagcacgaggcacatgagagcctggataatgaggacctggaggacgagaga
gacactgctgagagttactcagaccactccgtccaggagaagagggcgagtgatcacagc
agaggggaagttgtagctactgtacacgctatagtccctgtcccccacagggaagagcca
tcctacactggcagtcccctgagtgtacaccctctatcaatgacggtccagaatgggcaa
accatgacagacaggacggtcatggtcactccacagccgggggacggttcaccagcagat
ggggcactgactgggaccacccccatggttcctcaggagtccatcccaagccaagctccc
ctgggagactctgagaggcagaggcacgtgtctgcccccctgagctcatctcagctagcc
aatgcaggctccagcattcacctaatgccccagtgttatatgacccctaccagcccagag
agtagaagcactaacccccatcaccagccccccatgagtgtcatcagtgtcatcctcctg
accttccacatgtcccccctgaggccagcatacaccagcactgacccagcctccaccgcc
accctagccctagcagcctctctccctgaccctagcaccaggacccaagccctggctgcg
cccaccagcctacccacccctacctccgtgacaccctcctcaggggccactgtcacccca
gctgcaatcagccaggttcaggccactctgcccccagccgtccccactcacacccccggc
cccgtggccagcccagccctgaccctcatccacagcacggcccagggagatggtacctcc
tgcagcaactctggggtggcagcagggcaggcccagacccagcaaaagccacagccccag
cagcaggcccaccctccacagcaacagcagatgagctgcaactcctgtggttgccgtggc
agctgtggtaatagccactctgccgcccccaaccccaacttctccttccctccccagctg
grgcgccaggtcttcagcaatgcccacctccctctcttccacctcccatccatgtgcagc
actggatatcccagccaccgcagccaggtccaacaccagagcaacgccaccacctttcta
cccccctccacctcacacagccacccccacctyctcgccacctccacgccacccccacca
catgctggccacccaggctggatacaacctgcagcagatggcagctgctccctttaa

DBGET integrated database retrieval system