KEGG   Salvelinus alpinus (Arctic char): 111958188Help
Entry
111958188         CDS       T05762                                 

Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00512  Mucin type O-glycan biosynthesis
salp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    111958188
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:salp01003]
    111958188
Enzymes [BR:salp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     111958188
Glycosyltransferases [BR:salp01003]
 O-Glycan biosynthesis
  Mucin-type
   111958188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 111958188
NCBI-ProteinID: XP_023835152
LinkDB All DBs
AA seq 605 aa AA seqDB search
MAVARKIKTLLTVNIFVFVGIILFSVYCRIQDRSEELIQIGRISDQRLRARNGKVSNLVD
RQSILQRLERLEDVVYNQLNGLAKPMGLVEGPGGLGQGGAAATLGDDSHVDGEGKYEDYG
YNAQLSDRISLDRSIPDYRPKKCKQLTYPEDLPQISVVFIFVNEALSVILRSVHSVVNHT
PAHLLKEIILVDDNSDSVELKFNLDQYVNKRYPGLVKIVRNSKREGLIRARIHGWNAATA
PVVGFFDAHVEFNTAWAEPILTRVKEDHTRIILPAIDNIKFNTFEVQQYANAAHGYNWGL
WCMYIIPPQEWLDKGDETAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGM
RVWQCGGSMEVLPCARVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEYKSHVYMAWNI
PMNNPGVDYGDVSERVALRKRLQCRSFRWYLENVYPEMRIYNNTITYGEVRNSKASGYCL
DQGSEDDDKAILYPCHGMSSQLARYSTEGLLQLGPLGSTTFLPDTKCLIDDGRGRTPSLK
KCDSVSRVSQRLWDFTQNGPIISRDTGRCMEVEMSKDANFGLRLVVQRCSGQKWMIRNWI
KHPKH
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcacgcaaaataaaaactttgctcacggttaacatttttgtttttgtgggg
atcatattgttctcggtatattgtagaatacaggaccgttctgaggaactcattcagatc
ggcaggatatcagaccagagactgagggccaggaatggcaaagtttccaacttggtggac
aggcagtccatacttcagagactggagcggctggaggacgttgtctacaaccaattaaat
ggtctggctaagcccatggggctggtggaggggcctggaggtctgggccagggaggagca
gctgctactctgggggacgacagccatgttgacggggaggggaagtacgaggactatggc
tacaacgcccagctcagtgaccgcatctccctggaccgcagcatccccgactacagaccc
aaaaagtgcaagcagttgacctacccagaggacctccctcagatctcagtggtgttcatc
tttgtgaatgaggccttgtcggtcatcttgcggtccgtccacagcgtggtcaaccacacc
cctgcacaccttctcaaggagatcatcctggtggacgacaacagtgacagtgtggagctg
aagttcaatctggaccagtatgtgaacaagcgttacccaggtctggtgaagatcgtccgc
aacagtaagagggaaggcctgatccgagccaggatacacggttggaatgctgcaaccgcc
ccggtcgtaggtttctttgatgcccatgtagagttcaacactgcctgggcggagcctatc
ctgaccagggtgaaggaggaccacacccggatcatcctcccggccatcgacaacatcaag
ttcaacacattcgaggtgcagcagtacgccaacgcggcccacggctacaactggggcctg
tggtgcatgtacatcatcccccctcaggagtggctggacaagggcgatgagacagctccc
atcaggacgccagctatgatcggctgctcctttgtggtggacagagaatactttggtgag
atcggcctccttgatcctggcatggaagtctatggaggcgagaacattgagcttggcatg
cgggtgtggcagtgtggggggagcatggaggtgctgccctgcgccagagtggcgcacatc
gagcggaccaagaagccatacaacaacgacattgactactacgccaagaggaacgccctg
cgggccgccgaggtctggatggatgagtacaagtcccacgtctacatggcctggaacatc
cccatgaataaccctggggttgactatggggacgtgtctgagcgggtggccttgaggaag
aggctgcagtgtcggagcttccgctggtacctggagaatgtctacccagagatgcgcatc
tacaacaacaccatcacatatggggaggtcagaaacagtaaagccagtggctactgtctg
gaccagggatcagaggacgatgacaaagccatcctctatccctgccacgggatgtcctca
cagcttgcccgttactcaacagaggggcttctacaactaggacccctagggtcgaccacc
tttctgcctgacaccaaatgtctcatcgacgacggaagagggcgcacgcccagcttgaaa
aaatgtgactctgtttcgcgggtttcccagaggttgtgggattttacacagaatggtcca
atcatcagcagggacactggacggtgcatggaggtggagatgtccaaagatgccaacttc
ggccttcgactggtggttcagaggtgttctggtcaaaagtggatgatacggaactggata
aagcatccgaagcattga

DBGET integrated database retrieval system