KEGG   Salvelinus alpinus (Arctic char): 111960277
Entry
111960277         CDS       T05762                                 

Definition
(RefSeq) putative transcription factor p65 homolog
  KO
K04735  transcription factor p65
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04137  Mitophagy - animal
salp04210  Apoptosis
salp04218  Cellular senescence
salp04620  Toll-like receptor signaling pathway
salp04621  NOD-like receptor signaling pathway
salp04622  RIG-I-like receptor signaling pathway
salp04623  Cytosolic DNA-sensing pathway
salp04625  C-type lectin receptor signaling pathway
salp04920  Adipocytokine signaling pathway
salp05132  Salmonella infection
salp05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111960277
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111960277
  09143 Cell growth and death
   04210 Apoptosis
    111960277
   04218 Cellular senescence
    111960277
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111960277
   04621 NOD-like receptor signaling pathway
    111960277
   04622 RIG-I-like receptor signaling pathway
    111960277
   04623 Cytosolic DNA-sensing pathway
    111960277
   04625 C-type lectin receptor signaling pathway
    111960277
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111960277
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111960277
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111960277
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:salp03000]
    111960277
Transcription factors [BR:salp03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    111960277
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer PBP_N
Other DBs
NCBI-GeneID: 111960277
NCBI-ProteinID: XP_023837968
LinkDB
AA seq 607 aa
MDGMYGWEQAPLNQGNPFIEIIEQPKQRGMRFRYKCEGRSAGSTPGEKSNDTTKTHPAIK
VHNYNGPLRVRVSLVTKNPPHKPHPHELVGKDCKHGYYEADLQERRVHSFQNLGIQCVKK
KDVAEAVSCRLQTKNNPFNIPEANMWEEFDLNAVRLCFQASITLPTGELCPLEPVVSQPI
YDNRAPNTAELKICRVNRNSGSCMGGDEIYLLCDKVQKEDIEVRFFQDSWEGKGIFSQAD
VHRQVAIVFNTPPYCDTNLTEPIRVKMQLRRPSDREVSEPMDFQFLPSDPDEYGLMEKRK
RTEGMLQNLKLGSLMSGAMPAGTRPFNIARRTVTAKPAASQPVNPVAPPSXVSVKPQLYY
NGPQPGQLFQTQPKAEASTTAETWKFLNSLTLDSQPKATPVASFTTNPQASAATAASSQA
FPTVNLSDLHGFSFHTFACPQEPVSAAATPEPTSSFGVQGSQFKVDEELPEFPSFSEAQP
AGTLDSINIDDFQAMLGQSCLAGEGPKSSEASAPQAPCHLPSTNNEAQNQADPANHHISC
GGSTWMNYPNSIVNLLQNEGMMDSSPGNASQPAALDDLDVLSSIDEDRLMSILSSGNQYS
FVSGHQT
NT seq 1824 nt   +upstreamnt  +downstreamnt
atggatggaatgtatggatgggaacaggcccctttgaaccaaggtaatcccttcattgag
atcattgaacagcccaagcagaggggcatgaggttcaggtacaagtgtgaggggcgctct
gcgggaagcaccccgggagagaagagcaatgacaccaccaagacacaccctgccattaag
gtccacaactacaatggccccctgcgtgtccgcgtctccttggtgaccaagaacccacct
cacaagccccacccgcacgaactagtggggaaagactgcaaacatggctactatgaggca
gacctgcaggagagacgagtacacagttttcagaacctgggcattcagtgtgtgaagaaa
aaggatgtggccgaggcagtttcctgtaggctgcagaccaaaaacaaccccttcaacatt
cctgaggcgaacatgtgggaggagtttgacctaaatgcagtgaggctgtgtttccaggcc
tcgatcactctgcctaccggggaactctgccctctggagcccgtggtgtctcagcccatc
tacgacaacagagcacccaacacagcagaactgaagatctgtcgagtgaaccgaaactct
ggaagctgcatggggggggatgagatctacttactctgtgacaaagtgcaaaaagaggac
attgaggtgcggttcttccaggactcgtgggaggggaagggcatcttctcccaggcggac
gtccacaggcaggtggccattgtgttcaacaccccgccctactgcgacaccaacctgacc
gagccaatccgagtgaagatgcagctccgcaggccctcggaccgtgaggtcagcgagcca
atggacttccagttcctgccctccgacccagatgaatatggactgatggagaagagaaaa
cggacagagggaatgttacagaatctgaagctggggtccctgatgtcaggggccatgcca
gcagggacaaggcctttcaacattgccaggagaacagtcaccgccaagccagcagctagc
cagcctgtgaacccagtggcgccccctagtgycgtctctgtgaagccccagctctactac
aacggcccccagccaggccagttgtttcaaacccagcccaaagcagaagcctccaccaca
gccgagacctggaagttcctcaacagcctgaccctggactcccagcccaaagccaccccc
gtggccagcttcaccaccaacccccaggcctctgcagccacagccgcctcctcccaggcc
tttcccaccgtaaacctgtcggacctccacggattttctttccacacmtttgcttgtccc
caggagccggtgagtgcagccgctaccccagagcccacctctagcttcggggtccaaggc
tcccagttcaaggtggacgaggagctacccgaattccccagcttttctgaggcacaaccg
gccgggactctagatagtataaacattgacgacttccaggctatgctgggccagagttgt
ctggctggagaagggccaaagagcagtgaggcgtcggcccctcaggcaccctgccactta
ccctccaccaacaacgaggcccagaaccaagcagacccagccaaccaccacatcagctgt
ggcggcagcacctggatgaactaccccaacagcattgtcaacctgctccagaacgagggc
atgatggacagttcccccggcaacgccagccagccggccgcccttgacgacctggacgtc
ttaagctccatagacgaagaccgtctcatgtccatcctgagcagtggcaaccaatacagt
tttgtgtccggacatcagacctaa

DBGET integrated database retrieval system