KEGG   Salvelinus alpinus (Arctic char): 111960727
Entry
111960727         CDS       T05762                                 

Gene name
nos2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00220  Arginine biosynthesis
salp00330  Arginine and proline metabolism
salp01100  Metabolic pathways
salp04020  Calcium signaling pathway
salp04146  Peroxisome
salp04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    111960727 (nos2)
   00330 Arginine and proline metabolism
    111960727 (nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111960727 (nos2)
   04020 Calcium signaling pathway
    111960727 (nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111960727 (nos2)
Enzymes [BR:salp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     111960727 (nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 111960727
NCBI-ProteinID: XP_023838685
LinkDB
AA seq 1100 aa
MAFPNMIMNCIYFTIMKMKLLQDDETKTSHQTKPNKWETRANRCPFSIPVRNVKDGSSLK
DMLHHQAVKNQPCTSXVCEGSVMTPKALMRGPKDATLEILPQAIDLINQYYKSFKIPKIE
HHLARLEEITMEIDSTGTYQLTFEELAFGARQAWRNAPRCIGRIQWSNLQLFDARKCKTT
QDMFQFLCEHLQFATNGGNLRSAITVFPPRKEDGHDFRVWNSQLLKYAGYQMPDGSIQGD
PSSVEFTKICIQLGWKPQYGLFDVLPLVLQVNGEDPDLYEIPXHLILEVSMEHPQHXWFK
DLGLKWYALPAVSNMLMEIGGLEFPACPFNGWYMGTEIGVRDFCDYQRYNILEEVGRRMG
LETHKLSSLWKDQALVTINVAVIYSFQKNKVTITDHHSAAESFMKHLETEFRLRGGCPAD
WAWLVPPMSGSLTPVLHHEMVNYILSPFFYYQPDPWXTHVWRNGEMCLKKQQISFKAVAR
AAFFSSTLMSRVLANRVRCTVLYATETGKSQTLAQRXNSMLNCAFNSRLLCMEDYNFSDM
EQESLLVVVTSTFGNGDSPGNGESFKKQLFSLQYLRNKLRYCVFGLGSKMYPQFCAFAHA
VDAKLDELGAERVTPTGEGDELNGQEEAFSAWALTALKDAYKEFNIQGQLSLQLPGAERF
XEAWDPLRYRIALESCPQDRITALSAIHSKTVFPMKLKSKHNLQSPHSSRSTILVELERE
RSAEVMNFSPGDHVGVFPGNLPQLVAGILKFLPHMPPTNQCLRLEYRSDTCRDDEKNWQT
VGRIPAXPLSQALTYFLDVTTPPCQNLLQKLSQLAKQDGQRQRLLTLAKDSQEYTTWKMF
RVPNFLEVLEEFPSLEPSAAFLLSQLPLLKPRLYSISSSPQLHPNELHLTLTVLNYHTQD
GQGPLHHGVCSTWLDTIKKGDLVPCFIYSSGGFHLPAEPSTPVILVGAGSGIAPFRSFWQ
QRLHDMKHPEFSGSPMSLVFGCQSSETDHLYQEETLEMRRRGVLKSVTSAYSRQPGLPKV
YVQDVLRERMAEEVLSVLHQKEGHFYVCGGVNMAQGVTLAVQEILSSKLGITLTQAGEYL
AQLKIQKRYHEDIFGAQFQK
NT seq 3303 nt   +upstreamnt  +downstreamnt
atggcatttccaaatatgataatgaactgcatttattttacaattatgaagatgaagctg
cttcaggatgatgaaaccaaaacgtctcaccagactaaaccaaataaatgggaaacgaga
gccaacaggtgtccgttttctatacctgtgcgtaacgtgaaggatggctcaagtctcaaa
gacatgctgcaccaccaggcagtcaagaaccaaccatgcacatcaakagtttgtgaaggt
tctgtcatgactccgaaggctctaatgcgaggtcccaaagatgctactcttgaaatccta
cctcaggctatcgacctaatcaaccaatactacaagtccttcaaaatccccaaaattgaa
caccacctcgccagattggaggaaattactatggagatagattccacaggaacctatcaa
ttgacttttgaggaattggcgtttggtgctcggcaagcatggaggaacgccccaagatgc
atcggcaggattcagtggtccaatttacaactgtttgatgccagaaagtgcaagactact
caggatatgttccagtttctgtgcgaacacttacagtttgccacaaatggaggaaaccta
aggtctgcgattaccgtctttcctccgagaaaggaagacgggcatgatttccgggtgtgg
aacagccagttgttgaagtatgcaggttaccagatgcctgatggcagtatccagggagac
ccatccagtgtagaattcactaagatctgtatccagcttggatggaaacctcaatacggc
ctcttcgatgtgttgccactagtcctacaggtcaacggggaggacccagacctttatgaa
atccctrcacacctgatcttggaggtttccatggaacacccccagcatakgtggttcaaa
gacctaggactgaagtggtatgctctgcctgcggtgtccaacatgctgatggagattggt
ggacttgaattcccagcctgtccctttaatggctggtacatgggcactgagattggcgtg
agggatttctgtgactatcagcgttataacatcttggaggaagtgggtcgcaggatgggc
ctggagacgcacaagctgtcctcactgtggaaggaccaggccttggtgaccatcaatgtt
gcagtcatatacagtttccagaagaacaaggtaaccatcacagaccaccactctgcagcc
gagtccttcatgaagcacttggagacagagttccggctgcgcggcggctgccctgcagac
tgggcctggctggttcctcccatgtctggctccctcacccccgtcttrcaccaygagatg
gtcaactacatcctctctcccttcttctactaccagcctgacccctggargacccatgtc
tggagaaatggagagatgtgcctgaagaagcaacagatcagcttcaaagcggtggccagg
gcggcgttcttttcttcaaccctcatgagcagagtgctggctaacagggtgcgctgcact
gtcctgtacgctactgaaacagggaaatcacagacattggcccagagastgaactccatg
ctaaactgtgccttcaactccaggttgctctgtatggaggactataacttcagtgacatg
gaacaggagagccttctggttgtggtaactagcacctttgggaatggagactcccctgga
aatggagagagttttaagaaacagcttttctccttgcagtatctcaggaacaagttaagg
tactgtgtgtttgggctgggctcgaagatgtacccacagttctgtgcattcgcccatgcc
gtggatgccaagctggaygagctgggggcagagcgggtgacgcccactggagagggggat
gaactgaacggacaggaggaggccttctctgcctgggctctcaccgctctcaaggatgcc
tataaggagttcaacatccagggacagctgagtctgcagctccctggggcagagcgattc
tgrgaggcctgggacccactgagataccgcatagcactggagagctgcccccaggaccgc
atcacagcactttcagccattcactctaaaacggtcttccctatgaaactgaagagcaaa
cataatctacagagcccccattcaagccggtccaccattttggtggagttggagagggag
agaagtgcagaggtcatgaacttttctccaggagaccatgttggtgttttcccagggaat
ctccctcaactggtggctggcatcctaaagttccttccccatatgcccccaaccaaccag
tgcctacgactggaataccgttctgacacctgccgagatgatgagaaaaactggcagact
gtcggacgcatcccagcatgrcctttgtctcaggcactcacctacttcctggatgtgacc
acgcckccctgtcagaacctcctccaraagctctctcagttggcgaaacaggacgggcar
cgccagcgtctactgaccttggcaaaggactctcaggagtacacgacctggaagatgttc
cgtgttcccaacttcctggaagtcctggaggagttcccgtctttagaaccctctgcagcc
ttcctcctcagccagctgcctctgctcaagccccgcctctactccatcagctcctcccct
cagctccaccccaatgagctacatctcactctgacagtgctcaactatcacacacaagat
ggacagggtcctcttcaccacggggtctgcagcacctggctggataccattaagaaagga
gacctggtaccatgttttatctacagttcaggtgggttccacctcccagcagagcccagc
actccagtcattctggtgggggctggcagtggcatcgcgcccttccgaagcttctggcaa
caacggttacacgacatgaaacacccagagttctctggaagtcctatgagcctggtgttt
ggctgccagagttcggagactgaccatttataccaagaggagacactggagatgagaagg
cgaggggtcctgaagagtgttacctccgcatattcccgccagccaggtctcccaaaggtc
tatgtccaggatgtactgagggagaggatggcagaggaggtgctgagtgtgttgcaccag
aaggagggtcacttctatgtgtgtgggggtgtgaacatggcccagggagttactctagca
gtacaggagattctgagcagcaagcttggcatcaccctcacccaggcaggagaatacctg
gcccagctaaagatccagaagaggtaccatgaggacatctttggagcccagtttcagaag
tga

DBGET integrated database retrieval system