KEGG   Salvelinus alpinus (Arctic char): 111962224
Entry
111962224         CDS       T05762                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04012  ErbB signaling pathway
salp04068  FoxO signaling pathway
salp04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111962224 (cdkn1b)
   04068 FoxO signaling pathway
    111962224 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111962224 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111962224
NCBI-ProteinID: XP_023840911
LinkDB
AA seq 182 aa
MSNVRVSNGSPTFERTDARFSDHPKPSACRNLFGPVDHEELRRDLKGHLQEIEETSSAKW
NFDFSSQTPLLNGRFEWELVDSKDIPRFYSRTQRSAKGLCPSGNNNVDLNGNSCVTPPQP
SENTERSESKEQCTGQRKRPACHDPSSQNKRSHNSSDEVPRCPALAHSVENTPRKTSPRT
QT
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtcaaatgttcgtgtttcaaatgggagccctacatttgaaaggaccgatgctcggttt
tcggatcaccccaaaccgtcagcctgcagaaaccttttcggcccggtggatcacgaagag
ttaaggagggatttaaagggacatttgcaagagattgaagagacgtcctcagcgaaatgg
aacttcgatttttcaagtcaaacacccctattaaacgggagattcgaatgggaattagtg
gatagtaaagacattccacgtttctacagcagaactcaacgatcggcaaagggcctttgc
ccctctgggaataataatgtggatcttaatgggaatagttgtgtgactccaccgcagccc
tctgaaaacacagaaaggtcggagagcaaagagcagtgcaccgggcagagaaaaagacca
gcctgccatgacccctcgtcccaaaataaaaggtcacacaacagttcggatgaagttcct
cgttgcccagccttggcgcattctgtagaaaatacacccaggaaaaccagtcccaggact
caaacgtga

DBGET integrated database retrieval system